Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G26910 209 / 3e-70 RPL10B ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) AT1G14320 209 / 5e-70 RPL10A, RPL10, SAC52 SUPPRESSOR OF ACAULIS 52, ribosomal protein L10 A, ribosomal protein L10, Ribosomal protein L16p/L10e family protein (.1.2) AT1G66580 197 / 2e-65 RPL10C, SAG24 ribosomal protein L10 C, senescence associated gene 24 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010429 [exp] 249 / 2e-87 AT1G26910 209 / 3e-70 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Lus10031568 [exp] 241 / 3e-84 AT1G26910 209 / 5e-70 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Lus10015106 [exp] 241 / 3e-84 AT1G26910 209 / 5e-70 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Lus10031002 [exp] 239 / 2e-83 AT1G26910 206 / 5e-69 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Lus10035401 [exp] 239 / 2e-83 AT1G26910 206 / 5e-69 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Lus10034092 [exp] 224 / 1e-77 AT1G26910 216 / 7e-73 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Lus10003055 [exp] 115 / 2e-34 AT1G26910 135 / 2e-41 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G131900 [exp] 226 / 9e-77 AT1G26910 410 / 6e-148 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Potri.013G159600 [exp] 223 / 1e-75 AT1G26910 411 / 3e-148 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Potri.013G159301 [exp] 135 / 7e-41 AT1G14320 222 / 2e-73 SUPPRESSOR OF ACAULIS 52, ribosomal protein L10 A, ribosomal protein L10, Ribosomal protein L16p/L10e family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00252 [flax] [poplar] Ribosomal_L16 Ribosomal protein L16p/L10e
Representative CDS sequence Show only first row Show all	>Lus10012113 pacid=23154966 polypeptide=Lus10012113 locus=Lus10012113.g ID=Lus10012113.BGIv1.0 annot-version=v1.0 ATGCTTTCGTGTGCTGGAGCTGATAGGCTCCAGACCGGTATGAGGGGTGCCTTTGGGAAGCCTCAGGGTGTCTGTGCTAGGGTTGCTATTGGGCAGGTTC TACTCTCTGTCCGTTGCAAGGACAGCAACAGCCAGCATGCTCAGGAGGCTCTGCGTCGTGCTAAGTTCAAGTTTCCTGGTCGCCAGAAGATCATTGTCAG CAGAAAATGGGGGTTCACCAAGTTCAATCGTGCCGACTATGTGAAACTCAAGCAAGAGAACAGGATCATGCCCGACGGTGTCAATGCCAAGCTTCTTGGA TGCCATGGACCACTGGCCAACCGCCAGCCCGGCCGAGCATTTGCTCCGACTCCTCTCACTGCTTAG
AA sequence Show only first row Show all	>Lus10012113 pacid=23154966 polypeptide=Lus10012113 locus=Lus10012113.g ID=Lus10012113.BGIv1.0 annot-version=v1.0 MLSCAGADRLQTGMRGAFGKPQGVCARVAIGQVLLSVRCKDSNSQHAQEALRRAKFKFPGRQKIIVSRKWGFTKFNRADYVKLKQENRIMPDGVNAKLLG CHGPLANRQPGRAFAPTPLTA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G26910		RPL10B	ribosomal protein L10 B, Ribos...		Lus10012113 [exp]	0	1
AT5G62270			unknown protein		Lus10021682 [exp]	1.0	0.9171
AT1G65270			unknown protein		Lus10026847 [exp]	3.0	0.8955
AT5G57290			60S acidic ribosomal protein f...		Lus10010890 [exp]	8.4	0.9141
AT4G00390	GeBP		DNA-binding storekeeper protei...		Lus10018859 [exp]	9.9	0.8605
AT1G26340		B5 #6, B5#6, AT...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Lus10036973 [exp]	12.0	0.8665
AT1G07920			GTP binding Elongation factor ...		Lus10026488 [exp]	13.3	0.8562
AT1G16740			Ribosomal protein L20 (.1)		Lus10033326 [exp]	20.2	0.8287
AT3G44590			60S acidic ribosomal protein f...		Lus10020575 [exp]	21.4	0.8823
AT5G24510			60S acidic ribosomal protein f...		Lus10028876 [exp]	21.8	0.8842
AT1G04980		ATPDI10, ATPDIL...	ARABIDOPSIS THALIANA PROTEIN D...		Lus10029954 [exp]	24.7	0.8635

Compare expression of checked genes

Lus10012113 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.