Lus10012132 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012134 181 / 9e-60 AT5G40380 37 / 0.002 cysteine-rich RLK (RECEPTOR-like protein kinase) 42 (.1)
Lus10010417 167 / 3e-54 ND 37 / 0.002
Lus10012130 167 / 4e-54 ND 39 / 4e-04
Lus10012129 166 / 1e-53 ND /
Lus10012128 158 / 1e-50 ND /
Lus10012131 156 / 5e-50 ND 36 / 0.005
Lus10010416 155 / 2e-49 ND 36 / 0.004
Lus10010418 153 / 2e-48 ND /
Lus10010415 83 / 8e-21 ND /
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10012132 pacid=23154991 polypeptide=Lus10012132 locus=Lus10012132.g ID=Lus10012132.BGIv1.0 annot-version=v1.0
ATGCAGCATCCGCCGCCGACCATATACGTGATGTTGGTGCAGTCACTACTGATTGTAACATCAACAACAATGATGATGATGTCGGCAGTGAACTGTTACG
ACGACCAATCTGGATTCTGTGCCGGACCTGAAAACGTATGCAGGTACAGCCAAAACATGCTGCCGGCGGGAGTCACTCTATATGAAATATACCTCAATTT
CTACGCACGTGCTTTCGATTCTCCAGCCGTTTGCCGCCGTTTAGATCTGCCACAGCATCCGGATTTCAAACCCTATGCTTACTTTTCGTGCAACCTTGAC
AACTGCTACGCCTGCTACGACGACGCCTTCACGCGCATGAGGAACGCGGGCGGATGCTCCGACAAAGACGGCGCTTTCATGTCGTTGGAGGGTTGCTGTT
TAAGGTACGAGACGTACAGCTTCTGCGCCGCTCAAAACTGA
AA sequence
>Lus10012132 pacid=23154991 polypeptide=Lus10012132 locus=Lus10012132.g ID=Lus10012132.BGIv1.0 annot-version=v1.0
MQHPPPTIYVMLVQSLLIVTSTTMMMMSAVNCYDDQSGFCAGPENVCRYSQNMLPAGVTLYEIYLNFYARAFDSPAVCRRLDLPQHPDFKPYAYFSCNLD
NCYACYDDAFTRMRNAGGCSDKDGAFMSLEGCCLRYETYSFCAAQN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10012132 0 1
AT3G07840 Pectin lyase-like superfamily ... Lus10011030 1.0 0.9552
Lus10010271 1.4 0.9526
Lus10000890 3.2 0.8824
AT1G22400 ATUGT85A1, UGT8... ARABIDOPSIS THALIANA UDP-GLUCO... Lus10027514 6.2 0.8737
AT5G01250 alpha 1,4-glycosyltransferase ... Lus10035526 6.9 0.8512
AT2G37890 Mitochondrial substrate carrie... Lus10036193 7.3 0.8565
Lus10025017 7.7 0.8432
AT1G78410 VQ motif-containing protein (.... Lus10023308 9.8 0.9197
AT2G21610 PE11, ATPE11 A. THALIANA PECTINESTERASE 11,... Lus10042315 10.7 0.8126
AT3G07960 PIP5K6 phosphatidylinositol-4-phospha... Lus10039507 11.5 0.8540

Lus10012132 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.