Lus10012134 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010418 189 / 1e-62 ND /
Lus10012132 186 / 1e-61 ND 38 / 0.001
Lus10010416 184 / 4e-61 ND 36 / 0.004
Lus10010417 181 / 6e-60 ND 37 / 0.002
Lus10012130 166 / 1e-53 ND 39 / 4e-04
Lus10012129 159 / 5e-51 ND /
Lus10012128 155 / 7e-50 ND /
Lus10012131 154 / 3e-49 ND 36 / 0.005
Lus10010415 91 / 5e-24 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G141400 42 / 4e-05 AT5G40380 390 / 6e-127 cysteine-rich RLK (RECEPTOR-like protein kinase) 42 (.1)
Potri.017G141300 41 / 0.0001 AT5G40380 382 / 4e-123 cysteine-rich RLK (RECEPTOR-like protein kinase) 42 (.1)
Potri.007G120601 38 / 0.0008 AT3G22060 199 / 9e-65 Receptor-like protein kinase-related family protein (.1)
Potri.007G120300 38 / 0.001 AT3G22060 194 / 1e-61 Receptor-like protein kinase-related family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10012134 pacid=23154974 polypeptide=Lus10012134 locus=Lus10012134.g ID=Lus10012134.BGIv1.0 annot-version=v1.0
ATGTCGTCGCCGCCGACAACCATATACGTGATTGTAACATTAACAGTGATGATGACGTGGGCAGTAGACTGTTACGACGACAACTCTGGAATCTGTCAAG
GACCTGAGAACGTCTGCAGGCACAGCCAAAACATGTTGCCGGAAGGGGTCACCCAACAAGACATATCCGACAATTTTCACGCGCGAGCCTTCGATTCTCC
AGCTGTTTGCCGCCGTTTAGACTCTCTGTCAGAGGATACCAATTTCAAAATATACGCTTACTTCTCCTGCAGCCTTTCACACTGTTACCGCTGTTACGAC
GCCGCCTTCACGCTCCTGAGGACCACATATGGATGTTCCGGTAAAGACGGCGGTTTCGTCACGCTGGATGGCTGTTGCTTAAGGTATGAGACCTACGACT
TCTGCGGCGCTAAGAACCACTTGTAG
AA sequence
>Lus10012134 pacid=23154974 polypeptide=Lus10012134 locus=Lus10012134.g ID=Lus10012134.BGIv1.0 annot-version=v1.0
MSSPPTTIYVIVTLTVMMTWAVDCYDDNSGICQGPENVCRHSQNMLPEGVTQQDISDNFHARAFDSPAVCRRLDSLSEDTNFKIYAYFSCSLSHCYRCYD
AAFTLLRTTYGCSGKDGGFVTLDGCCLRYETYDFCGAKNHL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G40380 CRK42 cysteine-rich RLK (RECEPTOR-li... Lus10012134 0 1
AT5G59190 subtilase family protein (.1) Lus10000018 5.7 0.6975
AT1G63300 Myosin heavy chain-related pro... Lus10017237 24.7 0.6747
AT2G31390 STH pfkB-like carbohydrate kinase ... Lus10039195 34.7 0.6699
AT1G76140 Prolyl oligopeptidase family p... Lus10034556 40.1 0.6403
AT2G19130 S-locus lectin protein kinase ... Lus10029802 43.0 0.6405
AT1G03055 unknown protein Lus10024837 68.0 0.6092
AT1G16130 WAKL2 wall associated kinase-like 2 ... Lus10004504 84.5 0.5898
AT4G21330 bHLH bHLH022, DYT1 DYSFUNCTIONAL TAPETUM 1, basic... Lus10018395 88.1 0.5610
AT3G47570 Leucine-rich repeat protein ki... Lus10016896 105.4 0.5615
AT3G01470 HD HD-ZIP-1, HAT5,... HOMEODOMAIN PROTEIN FROM ARABI... Lus10013277 112.5 0.5030

Lus10012134 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.