Lus10012140 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G45590 127 / 2e-37 Ribosomal protein L35 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010406 234 / 1e-79 AT5G45590 147 / 1e-45 Ribosomal protein L35 (.1)
Lus10010409 234 / 1e-79 AT5G45590 147 / 1e-45 Ribosomal protein L35 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G099900 128 / 4e-38 AT5G45590 134 / 2e-40 Ribosomal protein L35 (.1)
Potri.001G133600 122 / 8e-36 AT5G45590 105 / 3e-29 Ribosomal protein L35 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01632 Ribosomal_L35p Ribosomal protein L35
Representative CDS sequence
>Lus10012140 pacid=23154965 polypeptide=Lus10012140 locus=Lus10012140.g ID=Lus10012140.BGIv1.0 annot-version=v1.0
ATGCTGAGATTCTGCACAAAGCTCCGCTCTATAGCGGCGCAATCGTCGGCGGCGTCACAATCTCCGATCTTCCTGCAATCTTCCCGTATCCTTATTAATC
ATTCTTCTCCGCAAATCCCTTCCAAATGCCGATCTCTCCACTCCGGAGCTGCTTCCACTGCTTGGAGTCTTAGCGGGCAGCTTATCAATGCGCCCAAGTT
ACCGTCTCCATTGGGTTCCTCGCCATCGCCCTTCTTTTTGGTGAGTGTCCGCTGTGTTTCGTCGAGGGAGCGGAAGAGGAGGAGGAAGCCGATGACGCCA
GTTACCTCCAAAGTGAAGAAGATTAAAATGAAGGGTTACTCTTCATACAAGGGCAGGTTTCGGCCATTGAAAGATGGGACTATTCGTCGTTGGCATGAGG
GTAAGAGACACAATGCACACTTGAAGTCGAGTAAAGCAAAGCGCAGACTTCGACAGCCTGCTCTCGTCCATCCAGCATATGCCACGGTCATGAAGAAGCT
CAACTTCTTCAACTAA
AA sequence
>Lus10012140 pacid=23154965 polypeptide=Lus10012140 locus=Lus10012140.g ID=Lus10012140.BGIv1.0 annot-version=v1.0
MLRFCTKLRSIAAQSSAASQSPIFLQSSRILINHSSPQIPSKCRSLHSGAASTAWSLSGQLINAPKLPSPLGSSPSPFFLVSVRCVSSRERKRRRKPMTP
VTSKVKKIKMKGYSSYKGRFRPLKDGTIRRWHEGKRHNAHLKSSKAKRRLRQPALVHPAYATVMKKLNFFN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G45590 Ribosomal protein L35 (.1) Lus10012140 0 1
AT5G50740 Heavy metal transport/detoxifi... Lus10030514 2.6 0.9503
AT5G19350 RNA-binding (RRM/RBD/RNP motif... Lus10031277 3.3 0.9340
AT5G24318 O-Glycosyl hydrolases family 1... Lus10040808 4.6 0.9436
AT4G26690 GDPDL3, GPDL2, ... SHAVEN 3, MUTANT ROOT HAIR 5, ... Lus10032576 5.2 0.9362
AT1G76160 SKS5 SKU5 similar 5 (.1) Lus10035282 7.5 0.9367
AT3G15010 RNA-binding (RRM/RBD/RNP motif... Lus10023817 7.7 0.9352
AT2G37270 ATRPS5B ribosomal protein 5B (.1.2) Lus10000946 8.7 0.9471
AT1G54510 ATNEK1 NIMA-related serine/threonine ... Lus10000148 10.1 0.9283
AT1G62500 Bifunctional inhibitor/lipid-t... Lus10032262 10.2 0.9387
AT4G27585 SPFH/Band 7/PHB domain-contain... Lus10015597 11.1 0.9432

Lus10012140 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.