Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G13660 71 / 3e-16 ATPRR2 pinoresinol reductase 2 (.1) AT1G32100 71 / 4e-16 ATPRR1 pinoresinol reductase 1 (.1) AT1G75290 67 / 1e-14 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT4G34540 64 / 6e-14 NmrA-like negative transcriptional regulator family protein (.1) AT1G75280 62 / 6e-13 NmrA-like negative transcriptional regulator family protein (.1) AT4G39230 61 / 1e-12 NmrA-like negative transcriptional regulator family protein (.1) AT1G75300 61 / 1e-12 NmrA-like negative transcriptional regulator family protein (.1) AT1G19540 49 / 2e-08 NmrA-like negative transcriptional regulator family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012145 [exp] 101 / 1e-27 AT1G32100 419 / 2e-148 pinoresinol reductase 1 (.1) Lus10010403 [exp] 92 / 7e-24 AT1G32100 446 / 1e-158 pinoresinol reductase 1 (.1) Lus10012143 [exp] 91 / 2e-23 AT1G32100 447 / 1e-159 pinoresinol reductase 1 (.1) Lus10040442 [exp] 67 / 7e-15 AT4G39230 462 / 2e-165 NmrA-like negative transcriptional regulator family protein (.1) Lus10023557 [exp] 67 / 1e-14 AT4G39230 461 / 2e-162 NmrA-like negative transcriptional regulator family protein (.1) Lus10026350 [exp] 65 / 5e-14 AT4G39230 454 / 3e-162 NmrA-like negative transcriptional regulator family protein (.1) Lus10040443 [exp] 64 / 1e-13 AT4G34540 290 / 5e-98 NmrA-like negative transcriptional regulator family protein (.1) Lus10026348 [exp] 64 / 2e-13 AT4G39230 442 / 2e-157 NmrA-like negative transcriptional regulator family protein (.1) Lus10042313 [exp] 63 / 2e-13 AT4G39230 369 / 2e-129 NmrA-like negative transcriptional regulator family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G100200 [exp] 85 / 2e-21 AT1G32100 462 / 2e-165 pinoresinol reductase 1 (.1) Potri.001G133300 [exp] 82 / 3e-20 AT1G32100 462 / 2e-165 pinoresinol reductase 1 (.1) Potri.011G168400 [exp] 69 / 2e-15 AT4G39230 448 / 2e-159 NmrA-like negative transcriptional regulator family protein (.1) Potri.005G228700 [exp] 66 / 2e-14 AT1G75280 451 / 3e-161 NmrA-like negative transcriptional regulator family protein (.1) Potri.009G118000 [exp] 66 / 3e-14 AT4G34540 432 / 7e-154 NmrA-like negative transcriptional regulator family protein (.1) Potri.002G034400 [exp] 65 / 5e-14 AT1G75280 467 / 2e-167 NmrA-like negative transcriptional regulator family protein (.1) Potri.009G118100 [exp] 64 / 7e-14 AT4G39230 501 / 0.0 NmrA-like negative transcriptional regulator family protein (.1) Potri.001G133200 [exp] 62 / 3e-13 AT1G32100 410 / 6e-145 pinoresinol reductase 1 (.1) Potri.007G036500 [exp] 62 / 4e-13 AT4G39230 407 / 1e-143 NmrA-like negative transcriptional regulator family protein (.1) Potri.009G118300 [exp] 60 / 3e-12 AT4G39230 488 / 8e-176 NmrA-like negative transcriptional regulator family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [flax] [poplar] NADP_Rossmann PF05368 [flax] [poplar] NmrA NmrA-like family
Representative CDS sequence Show only first row Show all	>Lus10012146 pacid=23154984 polypeptide=Lus10012146 locus=Lus10012146.g ID=Lus10012146.BGIv1.0 annot-version=v1.0 ATGAAATCATGCTTACTCGAATGTGAATATCCCCCCACACTCACATCTCGCCCACTCGGACCTCTAACCCCTCCCGACAAGGTCACCATCTATGGAGATG GCAGCGTCGAAGTGGTGTACATGGATGAAGATGATGTCGCCACTTACACGATCATGACGATGGAGGATGACCGGACACTGAACAAGACGATGTACCTCCG GCCACCGGAAGAATGTGATTACTCATAG
AA sequence Show only first row Show all	>Lus10012146 pacid=23154984 polypeptide=Lus10012146 locus=Lus10012146.g ID=Lus10012146.BGIv1.0 annot-version=v1.0 MKSCLLECEYPPTLTSRPLGPLTPPDKVTIYGDGSVEVVYMDEDDVATYTIMTMEDDRTLNKTMYLRPPEECDYS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34540			NmrA-like negative transcripti...		Lus10012146 [exp]	0	1
AT5G51030			NAD(P)-binding Rossmann-fold s...		Lus10032524 [exp]	1.7	1.0000
					Lus10032828 [exp]	4.5	1.0000
					Lus10004853 [exp]	5.2	1.0000
AT2G25940		ALPHAVPE, ALPHA...	alpha-vacuolar processing enzy...		Lus10033344 [exp]	5.3	1.0000
AT3G04120		GAPC1, GAPC-1, ...	glyceraldehyde-3-phosphate deh...		Lus10033306 [exp]	5.5	1.0000
					Lus10000273 [exp]	7.1	1.0000
AT2G29360			NAD(P)-binding Rossmann-fold s...		Lus10024359 [exp]	7.7	0.9145
AT2G01050			zinc ion binding;nucleic acid ...		Lus10032865 [exp]	8.0	0.7468
					Lus10022170 [exp]	8.3	0.8218
AT1G04670			unknown protein		Lus10002298 [exp]	8.8	1.0000

Compare expression of checked genes

Lus10012146 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.