Lus10012155 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G31817 166 / 1e-50 NFD3 NUCLEAR FUSION DEFECTIVE 3, Ribosomal L18p/L5e family protein (.1)
ATCG00750 52 / 8e-09 ATCG00750.1, RPS11 ribosomal protein S11 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007591 276 / 2e-96 AT1G31817 166 / 1e-51 NUCLEAR FUSION DEFECTIVE 3, Ribosomal L18p/L5e family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G117700 171 / 1e-52 AT1G31817 154 / 2e-44 NUCLEAR FUSION DEFECTIVE 3, Ribosomal L18p/L5e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0267 S11_L18p PF00411 Ribosomal_S11 Ribosomal protein S11
Representative CDS sequence
>Lus10012155 pacid=23154960 polypeptide=Lus10012155 locus=Lus10012155.g ID=Lus10012155.BGIv1.0 annot-version=v1.0
ATGTACTCTGCAATCTCGCACATTCGCAACAGTAGAGCAGCTCTATCCTCCTTCTCTTCTTCTGCTTCATCTTTGCTCCGTAGCCATGGCGGGTTCTCCA
CATTCTCACCTTTCTCTGCTCCCTCCCCTGCTTCTCCAGGTCCCAACCACGAGTCGAACAGGAACACGAAGCCAATGGACTATGTGAGGACAATTATGGA
TGAAAATGCTCAATTCACTAAGCACACCACCGAGGGAAACGAAGAGGTTGTCCACATAAAGCTGCTGCGAAACAACACCTTCGTCACAGTGACAGACCAG
AAAGGGAACACCAAGGTTGGAGGGCTCAAGGCTTCGTCAGGGATGGTGCCTGAGCTTAAAGGAGGGCCTAAGCTCTCTCGTTACGTTGCTGAAGCAACTT
CGGAGCACGTTGGGAGGAAGTCCAGAGAAATGGGGCTTAGATCGGTCGTGATTAAGGTCAACGGGTTTACCTTCTTCAAGAAGAAGAGGCAAGCTATCAT
GAGCTTCAAAGAAGGGTTCGGCCACAATATCGCTGCCATTGAAGACACTACGCGCAAGCCACATAATGGTTGCAGGCTGCCGAAGAAGCGCCGGATCTAG
AA sequence
>Lus10012155 pacid=23154960 polypeptide=Lus10012155 locus=Lus10012155.g ID=Lus10012155.BGIv1.0 annot-version=v1.0
MYSAISHIRNSRAALSSFSSSASSLLRSHGGFSTFSPFSAPSPASPGPNHESNRNTKPMDYVRTIMDENAQFTKHTTEGNEEVVHIKLLRNNTFVTVTDQ
KGNTKVGGLKASSGMVPELKGGPKLSRYVAEATSEHVGRKSREMGLRSVVIKVNGFTFFKKKRQAIMSFKEGFGHNIAAIEDTTRKPHNGCRLPKKRRI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G31817 NFD3 NUCLEAR FUSION DEFECTIVE 3, Ri... Lus10012155 0 1
AT5G41685 Mitochondrial outer membrane t... Lus10016473 1.0 0.8737
AT3G26360 Ribosomal protein S21 family p... Lus10006466 1.4 0.8575
AT3G10090 Nucleic acid-binding, OB-fold-... Lus10029320 4.2 0.8316
AT1G21720 PBC1 proteasome beta subunit C1 (.1... Lus10004885 5.0 0.8069
AT2G20280 C3HZnF Zinc finger C-x8-C-x5-C-x3-H t... Lus10023164 5.2 0.7746
AT1G51510 Y14 RNA-binding (RRM/RBD/RNP motif... Lus10003632 5.7 0.8103
AT4G13520 SMAP1 small acidic protein 1 (.1) Lus10023702 6.5 0.7926
AT1G22950 2-oxoglutarate (2OG) and Fe(II... Lus10000171 6.7 0.7668
AT2G27020 PAG1 20S proteasome alpha subunit G... Lus10041296 8.4 0.7719
AT5G11340 Acyl-CoA N-acyltransferases (N... Lus10008088 11.3 0.7601

Lus10012155 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.