Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G00585 89 / 1e-24 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007571 [exp] 100 / 4e-29 AT4G00585 153 / 3e-50 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G079800 [exp] 92 / 1e-25 AT4G00585 131 / 1e-41 unknown protein Potri.002G155800 [exp] 92 / 1e-25 AT4G00585 130 / 2e-41 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012175 pacid=23154978 polypeptide=Lus10012175 locus=Lus10012175.g ID=Lus10012175.BGIv1.0 annot-version=v1.0 ATGGGCGGAGGAGGTGAGCACGGACACGGAGCGGAAGGCTCCCATGGAGATTTCAGGGGGAAGGTGTGGAGCATGACTGGAGGACCTAATTGCCGCCCTA AGCACTGGCGCCGTAACACTGCCATCGCCATGGTCGGCGTCTTCCTCGTCTGTATCCCCATCGCCATGAAATCCGCCGAGCTTGAGCCGACCAGGTGGAT TAGTGTACTGATCTCGGTAGTGGCGTTGAGTCAGTGGTGGAACCACGGGCATTCTTTCTGGGCTCTTAAAACATCTCTAACCATGTTTAATTTCGTTTAA
AA sequence Show only first row Show all	>Lus10012175 pacid=23154978 polypeptide=Lus10012175 locus=Lus10012175.g ID=Lus10012175.BGIv1.0 annot-version=v1.0 MGGGGEHGHGAEGSHGDFRGKVWSMTGGPNCRPKHWRRNTAIAMVGVFLVCIPIAMKSAELEPTRWISVLISVVALSQWWNHGHSFWALKTSLTMFNFV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G00585			unknown protein		Lus10012175 [exp]	0	1
AT5G08300			Succinyl-CoA ligase, alpha sub...		Lus10013440 [exp]	1.7	0.9415
AT5G27430			Signal peptidase subunit (.1)		Lus10004463 [exp]	3.7	0.9240
AT1G22520			Domain of unknown function (DU...		Lus10009454 [exp]	6.9	0.9092
AT3G55010		EMB2818, ATPURM...	EMBRYO DEFECTIVE 2818, phospho...		Lus10024142 [exp]	7.3	0.9153
AT2G45060			Uncharacterised conserved prot...		Lus10028177 [exp]	11.0	0.8991
AT2G38130		ATMAK3	Acyl-CoA N-acyltransferases (N...		Lus10041514 [exp]	11.4	0.8552
AT1G32580			plastid developmental protein ...		Lus10011789 [exp]	12.2	0.9068
AT3G59470	FAR1_related		Far-red impaired responsive (F...		Lus10020226 [exp]	16.6	0.8651
AT1G65030			Transducin/WD40 repeat-like su...		Lus10038299 [exp]	17.1	0.9044
AT4G26270		PFK3	phosphofructokinase 3 (.1)		Lus10006032 [exp]	23.0	0.9084

Compare expression of checked genes

Lus10012175 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.