Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G32080 70 / 7e-17 unknown protein AT4G32090 66 / 5e-15 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) AT4G32110 62 / 1e-13 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) AT4G32105 57 / 2e-11 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) AT1G32583 54 / 3e-10 unknown protein AT4G32100 48 / 3e-08 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) AT4G24972 45 / 7e-07 TPD1 tapetum determinant 1 (.1) AT1G05835 45 / 7e-07 PHD finger protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007569 [exp] 161 / 5e-53 AT4G32110 64 / 2e-14 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Lus10042384 [exp] 130 / 2e-40 AT4G32110 81 / 1e-20 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Lus10026289 [exp] 125 / 3e-38 AT4G32090 72 / 5e-17 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Lus10001911 [exp] 50 / 8e-09 AT1G32583 157 / 5e-50 unknown protein Lus10022437 [exp] 50 / 3e-08 AT5G51140 505 / 1e-177 Pseudouridine synthase family protein (.1.2) Lus10016744 [exp] 49 / 6e-08 AT4G24972 172 / 5e-55 tapetum determinant 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G129400 [exp] 105 / 1e-30 AT4G32090 117 / 7e-35 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Potri.004G167900 [exp] 105 / 2e-30 AT4G32090 117 / 7e-35 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Potri.006G257600 [exp] 62 / 9e-14 AT4G32105 77 / 4e-19 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Potri.010G246900 [exp] 62 / 1e-13 AT1G32583 104 / 3e-29 unknown protein Potri.006G017600 [exp] 58 / 1e-11 AT1G32583 187 / 5e-61 unknown protein Potri.010G246300 [exp] 49 / 2e-08 AT1G32583 85 / 1e-21 unknown protein Potri.015G101000 [exp] 49 / 3e-08 AT1G32583 157 / 5e-49 unknown protein Potri.008G105600 [exp] 47 / 1e-07 AT4G24972 106 / 2e-29 tapetum determinant 1 (.1) Potri.012G102900 [exp] 47 / 2e-07 AT1G32583 160 / 2e-50 unknown protein Potri.002G233000 [exp] 44 / 2e-06 AT1G05835 111 / 2e-32 PHD finger protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012177 pacid=23154970 polypeptide=Lus10012177 locus=Lus10012177.g ID=Lus10012177.BGIv1.0 annot-version=v1.0 ATGAGTGGTTGCGATTTGAATAGCGTGACGATCGGGACAATAAGAAGTGGCAAGACGATCGGAGGCGAGACGGAGTGGAATGTGATTATAATTAACAACT GTGAATGCCCCGTAAGCAACCTAATCCTTTCATGCAAAGGATTTTCTACCGTTGAGAAATTAGACTCGTCCAAGTTTAAACAGATTGGAGGAGATAAATG CCTTGTAAATGATGGAAATCCTATTGCTCCAAAGAAGTCAATTAAGTTCTCTTATGCTTGGGAGCCTCCTTTGTATCTCTTCCCTGTAATCATCTCTAGC AAATGCTCTTAG
AA sequence Show only first row Show all	>Lus10012177 pacid=23154970 polypeptide=Lus10012177 locus=Lus10012177.g ID=Lus10012177.BGIv1.0 annot-version=v1.0 MSGCDLNSVTIGTIRSGKTIGGETEWNVIIINNCECPVSNLILSCKGFSTVEKLDSSKFKQIGGDKCLVNDGNPIAPKKSIKFSYAWEPPLYLFPVIISS KCS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G32090			Beta-1,3-N-Acetylglucosaminylt...		Lus10012177 [exp]	0	1
AT5G46230			Protein of unknown function, D...		Lus10000355 [exp]	2.0	0.9451
AT4G15390			HXXXD-type acyl-transferase fa...		Lus10032497 [exp]	2.2	0.9322
AT2G44840	AP2_ERF	ATERF13, EREBP	ethylene-responsive element bi...		Lus10030261 [exp]	5.5	0.9142
AT1G66140	C2H2ZnF	ZFP4	zinc finger protein 4 (.1)		Lus10035169 [exp]	6.6	0.9459
AT2G40390			unknown protein		Lus10009844 [exp]	11.0	0.9337
AT2G37360		ABCG2	ATP-binding cassette G2, ABC-2...		Lus10018624 [exp]	12.6	0.9425
AT1G71450	AP2_ERF		Integrase-type DNA-binding sup...		Lus10006173 [exp]	12.8	0.7513
AT5G07810			SNF2 domain-containing protein...		Lus10015736 [exp]	15.1	0.8679
AT3G19020			Leucine-rich repeat (LRR) fami...		Lus10012047 [exp]	19.4	0.9269
AT4G28110	MYB	ATMYB41	myb domain protein 41 (.1)		Lus10031607 [exp]	22.1	0.9252

Compare expression of checked genes

Lus10012177 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.