Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34810 120 / 1e-36 SAUR-like auxin-responsive protein family (.1) AT4G34800 115 / 5e-35 SAUR-like auxin-responsive protein family (.1) AT4G38840 110 / 7e-33 SAUR-like auxin-responsive protein family (.1) AT2G21210 110 / 1e-32 SAUR-like auxin-responsive protein family (.1) AT4G34790 106 / 6e-31 SAUR-like auxin-responsive protein family (.1) AT4G34770 102 / 1e-29 SAUR-like auxin-responsive protein family (.1) AT5G18030 99 / 2e-28 SAUR-like auxin-responsive protein family (.1) AT5G18020 99 / 2e-28 SAUR-like auxin-responsive protein family (.1) AT5G18080 98 / 7e-28 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) AT5G18060 98 / 8e-28 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007561 [exp] 173 / 2e-57 AT4G34810 125 / 1e-38 SAUR-like auxin-responsive protein family (.1) Lus10026294 [exp] 159 / 9e-52 AT4G34810 124 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10042378 [exp] 155 / 2e-50 AT4G34810 129 / 3e-40 SAUR-like auxin-responsive protein family (.1) Lus10042377 [exp] 146 / 1e-46 AT4G34810 120 / 6e-37 SAUR-like auxin-responsive protein family (.1) Lus10008995 [exp] 107 / 1e-31 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10008999 [exp] 103 / 5e-30 AT4G38840 117 / 7e-36 SAUR-like auxin-responsive protein family (.1) Lus10007560 [exp] 101 / 5e-29 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) Lus10012185 [exp] 100 / 8e-29 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) Lus10038193 [exp] 100 / 9e-29 AT4G38840 121 / 3e-37 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G127500 [exp] 118 / 7e-36 AT2G21210 128 / 5e-40 SAUR-like auxin-responsive protein family (.1) Potri.004G166100 [exp] 118 / 8e-36 AT2G21210 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Potri.004G165200 [exp] 110 / 7e-33 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126900 [exp] 110 / 1e-32 AT4G38840 131 / 1e-41 SAUR-like auxin-responsive protein family (.1) Potri.004G164800 [exp] 108 / 4e-32 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1) Potri.004G164700 [exp] 107 / 1e-31 AT5G18020 122 / 8e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G127600 [exp] 108 / 2e-31 AT5G18080 116 / 7e-35 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Potri.009G127700 [exp] 105 / 6e-31 AT5G18080 114 / 1e-34 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Potri.009G126500 [exp] 104 / 2e-30 AT5G18020 124 / 1e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126300 [exp] 104 / 2e-30 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10012184 pacid=23154926 polypeptide=Lus10012184 locus=Lus10012184.g ID=Lus10012184.BGIv1.0 annot-version=v1.0 ATGGGCATCGGCCGATTTGCGACCACAATGCTGAATGTCAAGCACAAGATCAAAGGGAAGTCCCTAATCCACCATCACCAAAGCACTGATCTAAGTACTA GCAGCAGTAGTAATAGTCATCTAAGTGTACCAAAGGGGCATGTTGCAGTCTATGTTGGAGAAGAGATGGAGATGATGATGAAGAGATTTGTGGTGCCAAT CTCTTACTTGAGCCACCCTTCGTTCCAAGACTTGCTTAGGAAAGCTGAGGAAGAGTTCGGTTTCGACCACCCAATGGGCGGACTCACTATCCCTTGTCGA GAGGACGCTTTCGTTGACCTCATCGCCTCTCATCGTGAAATTTCTTTGTGA
AA sequence Show only first row Show all	>Lus10012184 pacid=23154926 polypeptide=Lus10012184 locus=Lus10012184.g ID=Lus10012184.BGIv1.0 annot-version=v1.0 MGIGRFATTMLNVKHKIKGKSLIHHHQSTDLSTSSSSNSHLSVPKGHVAVYVGEEMEMMMKRFVVPISYLSHPSFQDLLRKAEEEFGFDHPMGGLTIPCR EDAFVDLIASHREISL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34810			SAUR-like auxin-responsive pro...		Lus10012184 [exp]	0	1
AT4G34810			SAUR-like auxin-responsive pro...		Lus10007561 [exp]	1.0	0.9910
					Lus10042799 [exp]	3.5	0.9863
AT2G42560			late embryogenesis abundant do...		Lus10000465 [exp]	16.2	0.9067
AT2G04220			Plant protein of unknown funct...		Lus10043317 [exp]	16.2	0.9889
AT5G14020			Endosomal targeting BRO1-like ...		Lus10031997 [exp]	18.6	0.9786
AT1G04610		YUC3	YUCCA 3 (.1)		Lus10035244 [exp]	19.9	0.9402
AT3G61640		AGP20, ATAGP20	arabinogalactan protein 20 (.1...		Lus10032355 [exp]	22.5	0.9860
AT1G56580		SVB	SMALLER WITH VARIABLE BRANCHES...		Lus10017655 [exp]	23.6	0.9728
AT1G17710		AtPEPC1	Arabidopsis thaliana phosphoet...		Lus10037652 [exp]	24.1	0.9439
AT3G28050			nodulin MtN21 /EamA-like trans...		Lus10030842 [exp]	26.6	0.9854

Compare expression of checked genes

Lus10012184 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.