Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34770 132 / 2e-41 SAUR-like auxin-responsive protein family (.1) AT4G34800 112 / 8e-34 SAUR-like auxin-responsive protein family (.1) AT2G21210 110 / 3e-33 SAUR-like auxin-responsive protein family (.1) AT4G38850 104 / 9e-31 SAUR-AC1, ATSAUR15, ATSR15AU, SAUR15, SAUR_AC1 SMALL AUXIN UP RNA 1 FROM ARABIDOPSIS THALIANA ECOTYPE COLUMBIA, ARABIDOPSIS COLUMBIA SAUR GENE 1, ARABIDOPSIS THALIANA SMALL AUXIN UPREGULATED 15, SAUR-like auxin-responsive protein family (.1) AT4G38840 103 / 3e-30 SAUR-like auxin-responsive protein family (.1) AT3G03820 102 / 6e-30 SAUR-like auxin-responsive protein family (.1) AT4G34810 102 / 7e-30 SAUR-like auxin-responsive protein family (.1) AT4G34780 100 / 4e-29 SAUR-like auxin-responsive protein family (.1) AT5G18080 100 / 4e-29 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) AT2G21200 100 / 5e-29 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007560 [exp] 177 / 2e-59 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) Lus10042376 [exp] 127 / 2e-39 AT4G34770 136 / 3e-43 SAUR-like auxin-responsive protein family (.1) Lus10025911 [exp] 112 / 6e-34 AT4G38840 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Lus10025909 [exp] 110 / 4e-33 AT4G34770 116 / 3e-35 SAUR-like auxin-responsive protein family (.1) Lus10039020 [exp] 110 / 6e-33 AT5G18020 118 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10029198 [exp] 110 / 9e-33 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10009620 [exp] 109 / 2e-32 AT4G38840 112 / 5e-34 SAUR-like auxin-responsive protein family (.1) Lus10027317 [exp] 106 / 2e-31 AT5G18030 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Lus10009621 [exp] 105 / 4e-31 AT4G38840 115 / 3e-35 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G165800 [exp] 133 / 4e-42 AT4G34770 152 / 2e-49 SAUR-like auxin-responsive protein family (.1) Potri.009G126700 [exp] 113 / 3e-34 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.009G126500 [exp] 110 / 4e-33 AT5G18020 124 / 1e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 110 / 6e-33 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.004G165600 [exp] 106 / 1e-31 AT4G34770 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Potri.009G126300 [exp] 105 / 2e-31 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G165200 [exp] 105 / 3e-31 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164800 [exp] 104 / 1e-30 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1) Potri.009G126400 [exp] 103 / 1e-30 AT5G18020 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Potri.009G126900 [exp] 103 / 1e-30 AT4G38840 131 / 1e-41 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10012185 pacid=23154969 polypeptide=Lus10012185 locus=Lus10012185.g ID=Lus10012185.BGIv1.0 annot-version=v1.0 ATGGGGATTGCTGAAAATGCAAGGCAAAAGCTACAAAGAACACTGTCAGCCAAACTATCTTCTTCTTCTTCTTCTTCCAATGTGCCAAAGGGCCATATTG CAGTCTATGTTGGTGAAGGCTACCTTAAGAAGAAGAGGTTCATCATCCCAGTCACTTACTTGAACCACCCTTTGTTCCAAGTCTTACTCGATCGAGCCGA GGAAGAGTTCGGGTTCGATCACCCCATGGGCGGACTCACCATCCCGTGCAGCGAGGAGTACTTCGTTAGTCTCACCTCCGCGCTCAGCTGTTAG
AA sequence Show only first row Show all	>Lus10012185 pacid=23154969 polypeptide=Lus10012185 locus=Lus10012185.g ID=Lus10012185.BGIv1.0 annot-version=v1.0 MGIAENARQKLQRTLSAKLSSSSSSSNVPKGHIAVYVGEGYLKKKRFIIPVTYLNHPLFQVLLDRAEEEFGFDHPMGGLTIPCSEEYFVSLTSALSC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34770			SAUR-like auxin-responsive pro...		Lus10012185 [exp]	0	1
AT4G16515		RGF6	root meristem growth factor 6,...		Lus10008506 [exp]	1.0	0.9948
AT3G61640		AGP20, ATAGP20	arabinogalactan protein 20 (.1...		Lus10032355 [exp]	3.0	0.9930
					Lus10019223 [exp]	13.5	0.9923
AT1G10740			alpha/beta-Hydrolases superfam...		Lus10030585 [exp]	13.6	0.9559
					Lus10025807 [exp]	14.4	0.9916
AT5G26830			Threonyl-tRNA synthetase (.1)		Lus10030843 [exp]	15.8	0.9931
AT2G20760			Clathrin light chain protein (...		Lus10018582 [exp]	17.3	0.9789
AT5G15350		AtENODL17	early nodulin-like protein 17 ...		Lus10026064 [exp]	17.6	0.9760
AT2G04220			Plant protein of unknown funct...		Lus10019467 [exp]	19.2	0.9878
AT3G09790		UBQ8	ubiquitin 8 (.1)		Lus10022258 [exp]	22.0	0.9887

Compare expression of checked genes

Lus10012185 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.