Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34760 170 / 2e-56 SAUR-like auxin-responsive protein family (.1) AT1G75580 158 / 1e-51 SAUR-like auxin-responsive protein family (.1) AT2G16580 154 / 7e-50 SAUR-like auxin-responsive protein family (.1) AT2G21220 151 / 6e-49 SAUR-like auxin-responsive protein family (.1) AT4G38860 145 / 1e-46 SAUR-like auxin-responsive protein family (.1) AT1G19830 144 / 7e-46 SAUR-like auxin-responsive protein family (.1) AT4G36110 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) AT2G18010 137 / 2e-43 SAUR-like auxin-responsive protein family (.1) AT5G66260 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) AT4G34770 91 / 4e-25 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007553 [exp] 220 / 4e-76 AT4G34760 168 / 9e-56 SAUR-like auxin-responsive protein family (.1) Lus10012432 [exp] 152 / 7e-49 AT1G75580 164 / 9e-54 SAUR-like auxin-responsive protein family (.1) Lus10024326 [exp] 150 / 2e-48 AT1G75580 166 / 2e-54 SAUR-like auxin-responsive protein family (.1) Lus10034511 [exp] 148 / 1e-47 AT1G75580 161 / 9e-53 SAUR-like auxin-responsive protein family (.1) Lus10033159 [exp] 146 / 8e-47 AT1G75580 160 / 1e-52 SAUR-like auxin-responsive protein family (.1) Lus10026296 [exp] 134 / 4e-42 AT4G34760 133 / 4e-42 SAUR-like auxin-responsive protein family (.1) Lus10028466 [exp] 129 / 4e-40 AT4G34760 151 / 5e-49 SAUR-like auxin-responsive protein family (.1) Lus10041921 [exp] 126 / 6e-39 AT4G34760 144 / 7e-46 SAUR-like auxin-responsive protein family (.1) Lus10032173 [exp] 100 / 2e-28 AT4G38840 119 / 3e-36 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G126000 [exp] 168 / 9e-56 AT4G34760 179 / 4e-60 SAUR-like auxin-responsive protein family (.1) Potri.004G164400 [exp] 164 / 4e-54 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1) Potri.007G012800 [exp] 149 / 4e-48 AT4G34760 164 / 3e-54 SAUR-like auxin-responsive protein family (.1) Potri.002G024300 [exp] 148 / 6e-48 AT1G75580 170 / 2e-56 SAUR-like auxin-responsive protein family (.1) Potri.005G237200 [exp] 145 / 1e-46 AT1G75580 164 / 5e-54 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 96 / 7e-27 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.004G165600 [exp] 92 / 1e-25 AT4G34770 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Potri.009G127700 [exp] 92 / 2e-25 AT5G18080 114 / 1e-34 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Potri.009G127500 [exp] 91 / 4e-25 AT2G21210 128 / 5e-40 SAUR-like auxin-responsive protein family (.1) Potri.009G127600 [exp] 92 / 5e-25 AT5G18080 116 / 7e-35 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10012189 pacid=23154902 polypeptide=Lus10012189 locus=Lus10012189.g ID=Lus10012189.BGIv1.0 annot-version=v1.0 ATGGGGATTAGGAAGCCAACCAGCAAGCCCTCACAAGCAACAGTGCTGAAGCAGATCCTCAAGAGATGCTCAAGCTTAGGCAAGAACAACAACAACAATC ATCAAGAACATTGGTTCCCTCCTGTTGATGTCCCCAAAGGCCACTTTGCAGTCTATGTTGGTGAGAACAGGAGTAGGTACATTGTCCCTATCTCCTTCCT AACCCACCCCGAGTTCCAGTTCCTACTCAGCAGGGCTGAGGAAGAGTTCGGTTTCGACCACGACATGGGCCTCACCATCCCTTGCGAGGAGGTCGTTTTC CGCTCCCTCACTTCCATGCTCAGATGA
AA sequence Show only first row Show all	>Lus10012189 pacid=23154902 polypeptide=Lus10012189 locus=Lus10012189.g ID=Lus10012189.BGIv1.0 annot-version=v1.0 MGIRKPTSKPSQATVLKQILKRCSSLGKNNNNNHQEHWFPPVDVPKGHFAVYVGENRSRYIVPISFLTHPEFQFLLSRAEEEFGFDHDMGLTIPCEEVVF RSLTSMLR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34760			SAUR-like auxin-responsive pro...		Lus10012189 [exp]	0	1
AT4G34760			SAUR-like auxin-responsive pro...		Lus10007553 [exp]	1.0	0.9201
AT2G46500		UBDKGAMMA4, ATP...	UBIQUITIN-LIKE DOMAIN KINASE G...		Lus10003190 [exp]	4.9	0.8663
AT5G14450			GDSL-like Lipase/Acylhydrolase...		Lus10032094 [exp]	5.0	0.8563
AT5G37020	ARF	ARF8, ATARF8	auxin response factor 8 (.1.2)		Lus10031354 [exp]	5.5	0.8922
AT1G74160			unknown protein		Lus10034677 [exp]	5.7	0.8418
AT1G74160			unknown protein		Lus10017857 [exp]	6.9	0.8529
ATCG00500		ATCG00500.1, AC...	acetyl-CoA carboxylase carboxy...		Lus10002473 [exp]	9.0	0.8766
AT2G21200			SAUR-like auxin-responsive pro...		Lus10008992 [exp]	10.4	0.8417
					Lus10011725 [exp]	10.6	0.8440
AT5G59480			Haloacid dehalogenase-like hyd...		Lus10016518 [exp]	11.4	0.8287

Compare expression of checked genes

Lus10012189 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.