Lus10012190 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G34750 136 / 6e-42 SAUR-like auxin-responsive protein family (.1.2)
AT5G10990 120 / 1e-35 SAUR-like auxin-responsive protein family (.1)
AT1G19840 115 / 1e-33 SAUR-like auxin-responsive protein family (.1)
AT1G75590 114 / 3e-33 SAUR-like auxin-responsive protein family (.1)
AT3G43120 75 / 1e-17 SAUR-like auxin-responsive protein family (.1)
AT1G56150 72 / 3e-17 SAUR-like auxin-responsive protein family (.1)
AT2G24400 74 / 6e-17 SAUR-like auxin-responsive protein family (.1)
AT4G34770 72 / 6e-17 SAUR-like auxin-responsive protein family (.1)
AT5G20810 71 / 3e-16 SAUR-like auxin-responsive protein family (.1.2)
AT4G34760 69 / 8e-16 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034507 136 / 9e-42 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1)
Lus10026297 135 / 3e-41 AT5G10990 125 / 2e-37 SAUR-like auxin-responsive protein family (.1)
Lus10042374 134 / 3e-41 AT5G10990 125 / 8e-38 SAUR-like auxin-responsive protein family (.1)
Lus10033161 133 / 1e-40 AT1G75590 187 / 4e-62 SAUR-like auxin-responsive protein family (.1)
Lus10012426 119 / 5e-35 AT1G75590 181 / 2e-59 SAUR-like auxin-responsive protein family (.1)
Lus10024322 84 / 1e-21 AT1G75590 152 / 3e-48 SAUR-like auxin-responsive protein family (.1)
Lus10007552 71 / 3e-16 AT1G75590 70 / 3e-16 SAUR-like auxin-responsive protein family (.1)
Lus10031754 70 / 7e-16 AT3G12830 170 / 2e-55 SAUR-like auxin-responsive protein family (.1)
Lus10008996 67 / 3e-15 AT4G38840 116 / 2e-35 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G164300 142 / 5e-44 AT5G10990 170 / 3e-55 SAUR-like auxin-responsive protein family (.1)
Potri.009G125900 138 / 2e-42 AT5G10990 157 / 5e-50 SAUR-like auxin-responsive protein family (.1)
Potri.005G237000 137 / 3e-42 AT1G75590 200 / 4e-67 SAUR-like auxin-responsive protein family (.1)
Potri.002G024500 134 / 5e-41 AT1G75590 194 / 1e-64 SAUR-like auxin-responsive protein family (.1)
Potri.006G278100 81 / 5e-20 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1)
Potri.008G037900 73 / 3e-17 AT2G37030 103 / 2e-29 SAUR-like auxin-responsive protein family (.1)
Potri.010G224500 72 / 6e-17 AT2G37030 103 / 2e-29 SAUR-like auxin-responsive protein family (.1)
Potri.006G070600 71 / 3e-16 AT5G18060 61 / 6e-13 SAUR-like auxin-responsive protein family (.1)
Potri.018G132400 71 / 3e-16 AT3G43120 64 / 2e-13 SAUR-like auxin-responsive protein family (.1)
Potri.005G096400 70 / 8e-16 AT3G12830 164 / 2e-53 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10012190 pacid=23154927 polypeptide=Lus10012190 locus=Lus10012190.g ID=Lus10012190.BGIv1.0 annot-version=v1.0
ATGTCGAAGTCCAACAAAATCCGCCACATCGTCAGAATCCACCAGATGCTCAAACAATGGCGCCGCAAGGCCCGTTCCTCCGCCGCCTCCTCCTCATCGC
CATCCGAAGTACCCGCCGGCCACGTGGCGGTCTACGTGGGCGCCACCTGCCGCCGATTCATCGTCCGGGCGACGTTCTTGAACCACCCGATATTCAATCG
AGTCCTGGCGATGGCGGAGGAAGAGTACGGGTTCGAGAATTCCGGGCCGCTCCGGATCCCCTGCGACGAGCGGGAGTTCGAGGAGGTGCTGAAGCTGGTC
TCCAGATCTGAATCGACGTCGGTGATCGGACGGTCGAGGAGGCTGGTGAGATTGGAAGACGTCCGTCGGTGTGCGTTTTACGGCGGGGATAAGGCAGTGA
TTGGCGGCGGCGGCGGCGGCGGGGAAGCGAGGCCGAGCGACTGA
AA sequence
>Lus10012190 pacid=23154927 polypeptide=Lus10012190 locus=Lus10012190.g ID=Lus10012190.BGIv1.0 annot-version=v1.0
MSKSNKIRHIVRIHQMLKQWRRKARSSAASSSSPSEVPAGHVAVYVGATCRRFIVRATFLNHPIFNRVLAMAEEEYGFENSGPLRIPCDEREFEEVLKLV
SRSESTSVIGRSRRLVRLEDVRRCAFYGGDKAVIGGGGGGGEARPSD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G34750 SAUR-like auxin-responsive pro... Lus10012190 0 1
AT1G11860 Glycine cleavage T-protein fam... Lus10001624 6.3 0.8417
AT1G75590 SAUR-like auxin-responsive pro... Lus10007552 14.4 0.7854
AT5G57360 LKP1, FKL2, ADO... ZEITLUPE, LOV KELCH PROTEIN 1,... Lus10015531 18.8 0.8106
AT5G46110 TPT, APE2 triose-phosphate ⁄ phosp... Lus10013978 20.6 0.8214
AT5G51150 Mitochondrial import inner mem... Lus10032508 24.7 0.7971
AT5G46110 TPT, APE2 triose-phosphate ⁄ phosp... Lus10015399 25.0 0.8202
AT4G01050 TROL thylakoid rhodanese-like (.1) Lus10029448 27.3 0.8153
AT2G22730 Major facilitator superfamily ... Lus10019244 29.5 0.7823
AT1G11860 Glycine cleavage T-protein fam... Lus10001441 31.8 0.8023
AT5G08720 unknown protein Lus10025701 33.2 0.8147

Lus10012190 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.