Lus10012195 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G18100 228 / 2e-78 Ribosomal protein L32e (.1)
AT5G46430 224 / 3e-77 Ribosomal protein L32e (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007541 247 / 6e-86 AT4G18100 246 / 1e-85 Ribosomal protein L32e (.1)
Lus10011970 245 / 3e-85 AT4G18100 246 / 1e-85 Ribosomal protein L32e (.1)
Lus10004589 244 / 7e-85 AT4G18100 247 / 4e-86 Ribosomal protein L32e (.1)
Lus10020410 243 / 2e-84 AT4G18100 242 / 3e-84 Ribosomal protein L32e (.1)
Lus10031699 242 / 4e-84 AT4G18100 240 / 2e-83 Ribosomal protein L32e (.1)
Lus10009591 243 / 4e-83 AT4G18100 243 / 4e-83 Ribosomal protein L32e (.1)
Lus10031120 243 / 1e-80 AT3G22660 289 / 9e-96 rRNA processing protein-related (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G353900 234 / 7e-81 AT4G18100 227 / 4e-78 Ribosomal protein L32e (.1)
Potri.014G191000 234 / 7e-81 AT4G18100 227 / 4e-78 Ribosomal protein L32e (.1)
Potri.002G249000 231 / 1e-79 AT4G18100 226 / 5e-78 Ribosomal protein L32e (.1)
Potri.011G078200 229 / 7e-79 AT4G18100 225 / 2e-77 Ribosomal protein L32e (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01655 Ribosomal_L32e Ribosomal protein L32
Representative CDS sequence
>Lus10012195 pacid=23154949 polypeptide=Lus10012195 locus=Lus10012195.g ID=Lus10012195.BGIv1.0 annot-version=v1.0
ATGGCGGTTCCTCTACTGACCAAAAAGATTGTGAAGAAGAGAGTCAAGCAGTTTAAGAGGCCTCAGAGTGACCGTAAGATATGTGTCAAGGAGAACTGGA
GGAGGCCAAAGGGTATTGACTCGAGGGTAAGGAGGAAGTTCAAAGGAGTTACTTTGATGCCCAACATTGGTTACGGGTCTGACAAGAAGACCCGACACTA
TCTCCCCAATGGGTTCAAGAAGTTTGTCGTCCATAACGTGAAGGAGCTTGAGGTCTTGATGATGCACAACAGGACTTACTGTGCGGAGATCGCGCATGAT
GTCTCGACCCGCAAGAGAAAGGATATTGTGGAGCGTGCAGCTCAGCTGGATATTGTTGTAACGAACAAGCTCGCTAGGTTGCGTAGCCAGGAAGATGAAT
AG
AA sequence
>Lus10012195 pacid=23154949 polypeptide=Lus10012195 locus=Lus10012195.g ID=Lus10012195.BGIv1.0 annot-version=v1.0
MAVPLLTKKIVKKRVKQFKRPQSDRKICVKENWRRPKGIDSRVRRKFKGVTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVKELEVLMMHNRTYCAEIAHD
VSTRKRKDIVERAAQLDIVVTNKLARLRSQEDE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G18100 Ribosomal protein L32e (.1) Lus10012195 0 1
AT3G52570 alpha/beta-Hydrolases superfam... Lus10021315 3.2 0.8853
AT3G61110 ARS27A ribosomal protein S27 (.1) Lus10031974 3.7 0.8705
AT3G10530 Transducin/WD40 repeat-like su... Lus10035740 4.0 0.8519
AT1G41880 Ribosomal protein L35Ae family... Lus10040235 5.5 0.8673
AT5G08180 Ribosomal protein L7Ae/L30e/S1... Lus10010993 7.1 0.8345
AT1G26880 Ribosomal protein L34e superfa... Lus10036750 12.0 0.8458
AT4G09800 RPS18C S18 ribosomal protein (.1) Lus10006914 12.2 0.8476
AT1G55205 unknown protein Lus10032319 12.7 0.7989
AT3G13580 Ribosomal protein L30/L7 famil... Lus10021296 12.7 0.8422
AT2G18400 ribosomal protein L6 family pr... Lus10026015 13.3 0.8264

Lus10012195 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.