Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G57500 38 / 0.0002 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007539 [exp] 0 / 1 ND 54 / 2e-10
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012197 pacid=23154972 polypeptide=Lus10012197 locus=Lus10012197.g ID=Lus10012197.BGIv1.0 annot-version=v1.0 ATGAGGGACTTGGAAGAAAGCAGCTGGCTAAACGGACTAGCACCGACCGCCATGGCCGCAGTGGCGCCGCCGGCGGAAGAAGGTGGCAGTGATGGACATT ACACGGGGAGATCAGTAGAGACGCTGGTGGTTGTGCTGGCAGTTATCATCATCGGCGCAGTGCTTGCTGGGTTCTTGGTCCGCTTATGTGGGGTCCGCCG CAGCGGAGAGCTTGACGTCGTTGAAGGCAGCTGGATCGAGAGGAAGTGCCGGAGCTGCATGGACGGTGGGGTCATCACTGCGGCTCCGCCTCCGCCAGCA CCGGAAGAGCCAAAGAAATAA
AA sequence Show only first row Show all	>Lus10012197 pacid=23154972 polypeptide=Lus10012197 locus=Lus10012197.g ID=Lus10012197.BGIv1.0 annot-version=v1.0 MRDLEESSWLNGLAPTAMAAVAPPAEEGGSDGHYTGRSVETLVVVLAVIIIGAVLAGFLVRLCGVRRSGELDVVEGSWIERKCRSCMDGGVITAAPPPPA PEEPKK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G57500			unknown protein		Lus10012197 [exp]	0	1
AT5G51330		DYAD, SWI1	SWITCH1 (.1)		Lus10009659 [exp]	2.6	0.6641
AT1G16930			F-box/RNI-like/FBD-like domain...		Lus10023037 [exp]	3.6	0.7204
AT2G21950		SKIP6	SKP1 interacting partner 6 (.1...		Lus10030883 [exp]	4.9	0.7003
AT2G27610			Tetratricopeptide repeat (TPR)...		Lus10020588 [exp]	10.0	0.6245
AT5G39050		PMAT1	phenolic glucoside malonyltran...		Lus10035802 [exp]	14.1	0.6812
AT5G41720			unknown protein		Lus10006473 [exp]	15.3	0.6814
AT5G26330			Cupredoxin superfamily protein...		Lus10002451 [exp]	26.8	0.6646
AT2G24450		FLA3	FASCICLIN-like arabinogalactan...		Lus10026957 [exp]	30.9	0.6631
AT4G13330			S-adenosyl-L-methionine-depend...		Lus10023725 [exp]	33.9	0.6100
AT4G40070			RING/U-box superfamily protein...		Lus10035931 [exp]	35.1	0.6719

Compare expression of checked genes

Lus10012197 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.