Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G45140 149 / 3e-43 NRPC2 nuclear RNA polymerase C2 (.1) AT4G21710 89 / 3e-22 NRPB2, EMB1989 EMBRYO DEFECTIVE 1989, DNA-directed RNA polymerase family protein (.1) AT3G18090 69 / 5e-15 NRPD2B nuclear RNA polymerase D2B (.1) AT3G23780 68 / 1e-14 NRPE2, DMS2, DRD2, NRPD2a DEFECTIVE IN MERISTEM SILENCING 2, nuclear RNA polymerase D2A (.1.2) AT1G29940 58 / 4e-11 NRPA2 nuclear RNA polymerase A2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017504 [exp] 158 / 2e-46 AT5G45140 1652 / 0.0 nuclear RNA polymerase C2 (.1) Lus10028778 [exp] 137 / 3e-39 AT5G45140 1711 / 0.0 nuclear RNA polymerase C2 (.1) Lus10011322 [exp] 106 / 2e-28 AT5G45140 468 / 2e-153 nuclear RNA polymerase C2 (.1) Lus10015446 [exp] 88 / 1e-21 AT4G21710 2298 / 0.0 EMBRYO DEFECTIVE 1989, DNA-directed RNA polymerase family protein (.1) Lus10011182 [exp] 76 / 3e-17 AT4G21710 2293 / 0.0 EMBRYO DEFECTIVE 1989, DNA-directed RNA polymerase family protein (.1) Lus10027166 [exp] 74 / 1e-16 AT3G23780 1435 / 0.0 DEFECTIVE IN MERISTEM SILENCING 2, nuclear RNA polymerase D2A (.1.2) Lus10039677 [exp] 74 / 1e-16 AT3G23780 696 / 0.0 DEFECTIVE IN MERISTEM SILENCING 2, nuclear RNA polymerase D2A (.1.2) Lus10026157 [exp] 59 / 2e-11 AT1G29940 1574 / 0.0 nuclear RNA polymerase A2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G003000 [exp] 139 / 1e-39 AT5G45140 1826 / 0.0 nuclear RNA polymerase C2 (.1) Potri.004G043200 [exp] 87 / 2e-21 AT4G21710 2271 / 0.0 EMBRYO DEFECTIVE 1989, DNA-directed RNA polymerase family protein (.1) Potri.018G019100 [exp] 71 / 5e-16 AT3G23780 1694 / 0.0 DEFECTIVE IN MERISTEM SILENCING 2, nuclear RNA polymerase D2A (.1.2) Potri.001G030750 [exp] 58 / 3e-11 AT1G29940 1674 / 0.0 nuclear RNA polymerase A2 (.1) Potri.006G263900 [exp] 42 / 2e-05 AT3G23780 253 / 5e-77 DEFECTIVE IN MERISTEM SILENCING 2, nuclear RNA polymerase D2A (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04560 [flax] [poplar] RNA_pol_Rpb2_7 RNA polymerase Rpb2, domain 7
Representative CDS sequence Show only first row Show all	>Lus10012207 pacid=23154956 polypeptide=Lus10012207 locus=Lus10012207.g ID=Lus10012207.BGIv1.0 annot-version=v1.0 ATGGAGCGCGACTGTTTGATTGCATATGGTGCTAGCATGCTGATGTACGAGGGCCTCTTGCTTTCAAGCGATCCATTTGAAGTTCAGGTTTGCCAAGTTT GCGGGTTGTTAGGGTATTACAACCACAAGATGAGAAGTGTGTTCTGTTCAACGTGCAAGAGTGGAGACAACGTTGCAACAATGAAACTGCCCTATGCTTG CAAGCTTTTGATCCAGGAGCTTCAATCCATGAACATTGTGCCTTGTCTGAAACTCCAGGACCCAGATGCATGA
AA sequence Show only first row Show all	>Lus10012207 pacid=23154956 polypeptide=Lus10012207 locus=Lus10012207.g ID=Lus10012207.BGIv1.0 annot-version=v1.0 MERDCLIAYGASMLMYEGLLLSSDPFEVQVCQVCGLLGYYNHKMRSVFCSTCKSGDNVATMKLPYACKLLIQELQSMNIVPCLKLQDPDA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G45140		NRPC2	nuclear RNA polymerase C2 (.1)		Lus10012207 [exp]	0	1

Compare expression of checked genes

Lus10012207 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.