Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52105 71 / 5e-18 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011321 [exp] 126 / 2e-40 AT3G52105 72 / 1e-18 unknown protein Lus10042363 [exp] 99 / 2e-29 AT3G52105 75 / 6e-20 unknown protein Lus10026305 [exp] 99 / 4e-26 AT3G57570 229 / 2e-65 ARM repeat superfamily protein (.1.2) Lus10029521 [exp] 82 / 8e-23 AT3G52105 85 / 8e-24 unknown protein Lus10016415 [exp] 77 / 1e-20 AT3G52105 81 / 3e-22 unknown protein Lus10019704 [exp] 77 / 2e-20 AT3G52105 80 / 6e-22 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G053400 [exp] 96 / 7e-28 AT3G52105 76 / 9e-20 unknown protein Potri.006G054200 [exp] 85 / 5e-24 AT3G52105 67 / 2e-16 unknown protein Potri.001G267501 [exp] 84 / 1e-23 AT3G52105 87 / 9e-25 unknown protein Potri.009G061800 [exp] 84 / 3e-23 AT3G52105 90 / 1e-25 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012208 pacid=23154930 polypeptide=Lus10012208 locus=Lus10012208.g ID=Lus10012208.BGIv1.0 annot-version=v1.0 ATGTTGCAACTCTTCTTCGCGGTTGCCATATCGGCGGTTCCGCTGACCCTGTACATACCGCCGATCCGCTCCCTGAACCTGTTCGTCGAGACGACCGAGG ATTTGCTCCGTCAGATGGCTTTCCATACGGTCAGGACTTATCCACGGATACGCTTCGCATTCTCTCGCATCCTGACCAGCCTCATCCGCCTCGCCAGGTA A
AA sequence Show only first row Show all	>Lus10012208 pacid=23154930 polypeptide=Lus10012208 locus=Lus10012208.g ID=Lus10012208.BGIv1.0 annot-version=v1.0 MLQLFFAVAISAVPLTLYIPPIRSLNLFVETTEDLLRQMAFHTVRTYPRIRFAFSRILTSLIRLAR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G52105			unknown protein		Lus10012208 [exp]	0	1
AT1G47410			unknown protein		Lus10009767 [exp]	3.7	0.9186
AT4G15248	CO		B-box type zinc finger family ...		Lus10027151 [exp]	4.2	0.9066
AT1G75390	bZIP	ATBZIP44	basic leucine-zipper 44 (.1.2)		Lus10040428 [exp]	6.8	0.9073
AT2G41905			unknown protein		Lus10040498 [exp]	6.9	0.9015
AT5G44060			unknown protein		Lus10003619 [exp]	10.1	0.8732
AT1G65720			unknown protein		Lus10031363 [exp]	10.2	0.8984
AT3G21150	CO	EIP6, BBX32	EMF1-Interacting Protein 1, B-...		Lus10033380 [exp]	11.0	0.8875
AT5G03110			unknown protein		Lus10026490 [exp]	11.6	0.8875
AT3G26330		CYP71B37	"cytochrome P450, family 71, s...		Lus10016599 [exp]	14.5	0.8929
AT2G37740	C2H2ZnF	ATZFP10, ZFP10	zinc-finger protein 10 (.1)		Lus10024875 [exp]	15.6	0.8844

Compare expression of checked genes

Lus10012208 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.