Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G51660 159 / 8e-52 Tautomerase/MIF superfamily protein (.1) AT5G01650 128 / 1e-39 Tautomerase/MIF superfamily protein (.1.2) AT5G57170 102 / 3e-29 Tautomerase/MIF superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000344 [exp] 146 / 2e-47 AT3G51660 96 / 2e-27 Tautomerase/MIF superfamily protein (.1) Lus10014233 [exp] 114 / 6e-34 AT5G01650 169 / 1e-55 Tautomerase/MIF superfamily protein (.1.2) Lus10022681 [exp] 113 / 2e-33 AT5G01650 172 / 8e-57 Tautomerase/MIF superfamily protein (.1.2) Lus10012223 [exp] 96 / 1e-26 AT5G01650 146 / 9e-47 Tautomerase/MIF superfamily protein (.1.2) Lus10033324 [exp] 63 / 1e-13 AT5G57170 119 / 1e-35 Tautomerase/MIF superfamily protein (.1.2) Lus10034783 [exp] 62 / 3e-13 AT5G57170 116 / 4e-34 Tautomerase/MIF superfamily protein (.1.2) Lus10000345 [exp] 40 / 0.0001 AT5G01650 52 / 2e-11 Tautomerase/MIF superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G127300 [exp] 169 / 4e-56 AT3G51660 151 / 7e-49 Tautomerase/MIF superfamily protein (.1) Potri.006G104800 [exp] 169 / 4e-56 AT3G51660 151 / 7e-49 Tautomerase/MIF superfamily protein (.1) Potri.006G104500 [exp] 128 / 9e-40 AT5G01650 200 / 5e-68 Tautomerase/MIF superfamily protein (.1.2) Potri.016G126600 [exp] 124 / 6e-38 AT5G01650 216 / 2e-74 Tautomerase/MIF superfamily protein (.1.2) Potri.016G126500 [exp] 123 / 8e-38 AT5G01650 193 / 2e-65 Tautomerase/MIF superfamily protein (.1.2) Potri.016G126800 [exp] 117 / 2e-35 AT5G01650 185 / 4e-62 Tautomerase/MIF superfamily protein (.1.2) Potri.006G104600 [exp] 111 / 7e-33 AT5G01650 180 / 3e-60 Tautomerase/MIF superfamily protein (.1.2) Potri.006G075100 [exp] 106 / 6e-31 AT5G57170 194 / 7e-66 Tautomerase/MIF superfamily protein (.1.2) Potri.016G126700 [exp] 104 / 4e-30 AT5G01650 164 / 6e-54 Tautomerase/MIF superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0082 [flax] [poplar] MIF PF01187 [flax] [poplar] MIF Macrophage migration inhibitory factor (MIF)
Representative CDS sequence Show only first row Show all	>Lus10012222 pacid=23172700 polypeptide=Lus10012222 locus=Lus10012222.g ID=Lus10012222.BGIv1.0 annot-version=v1.0 ATGCCTTGCCTGTACATCACCACGAACGTCAACCTCGACGGAGTTGACGCCGAGCCCGTCTTCTCCGACGCCACCAAAGCCATCGCTTCCATCGTCGGCC GGCCGGAGCACTTCGTAATGGTGGTGCTGAAAGGATCGGTGGCGATACGGTTCAACGGGAACAAGGAGCCGGCGGCTTACGCCGAGATAGTGGCTGTCGG CGGCATCACCAGAGAGATCAAAAGGAAGCTAATTGCCACACTGGGAGATGTTCTTCAGAACAGGCTATCTATTCCCAAGACTCGATTCATTCTCAAAGTA TTTGACACCACAACTGTTCCCCTGCCCATTACTTCCAAATTGTAA
AA sequence Show only first row Show all	>Lus10012222 pacid=23172700 polypeptide=Lus10012222 locus=Lus10012222.g ID=Lus10012222.BGIv1.0 annot-version=v1.0 MPCLYITTNVNLDGVDAEPVFSDATKAIASIVGRPEHFVMVVLKGSVAIRFNGNKEPAAYAEIVAVGGITREIKRKLIATLGDVLQNRLSIPKTRFILKV FDTTTVPLPITSKL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G51660			Tautomerase/MIF superfamily pr...		Lus10012222 [exp]	0	1
AT4G15560		AtCLA1, DXS, DX...	1-DEOXY-D-XYLULOSE 5-PHOSPHATE...		Lus10015519 [exp]	5.2	0.9264
AT4G24290			MAC/Perforin domain-containing...		Lus10012717 [exp]	9.7	0.9105
AT2G18420			Gibberellin-regulated family p...		Lus10021098 [exp]	13.0	0.8997
AT4G16820		PLA-I{beta]2	phospholipase A I beta 2, alph...		Lus10000600 [exp]	17.0	0.8986
AT1G03590			Protein phosphatase 2C family ...		Lus10033708 [exp]	18.1	0.9052
AT5G44390			FAD-binding Berberine family p...		Lus10001965 [exp]	21.3	0.9102
AT2G48010		RKF3	receptor-like kinase in in flo...		Lus10027970 [exp]	23.7	0.8549
AT4G03140			NAD(P)-binding Rossmann-fold s...		Lus10029370 [exp]	28.2	0.8811
AT5G64300		ATGCH, ATRIBA1,...	RED FLUORESCENT IN DARKNESS 1,...		Lus10035929 [exp]	31.9	0.9021
AT3G51520			diacylglycerol acyltransferase...		Lus10039135 [exp]	33.1	0.9018

Compare expression of checked genes

Lus10012222 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.