Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G01650 145 / 3e-46 Tautomerase/MIF superfamily protein (.1.2) AT3G51660 89 / 3e-24 Tautomerase/MIF superfamily protein (.1) AT5G57170 88 / 9e-24 Tautomerase/MIF superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022681 [exp] 141 / 1e-44 AT5G01650 172 / 8e-57 Tautomerase/MIF superfamily protein (.1.2) Lus10014233 [exp] 133 / 1e-41 AT5G01650 169 / 1e-55 Tautomerase/MIF superfamily protein (.1.2) Lus10012222 [exp] 96 / 1e-26 AT3G51660 158 / 1e-51 Tautomerase/MIF superfamily protein (.1) Lus10033324 [exp] 69 / 6e-16 AT5G57170 119 / 1e-35 Tautomerase/MIF superfamily protein (.1.2) Lus10034783 [exp] 67 / 6e-15 AT5G57170 116 / 4e-34 Tautomerase/MIF superfamily protein (.1.2) Lus10000344 [exp] 62 / 6e-14 AT3G51660 96 / 2e-27 Tautomerase/MIF superfamily protein (.1) Lus10000345 [exp] 0 / 1 AT5G01650 52 / 2e-11 Tautomerase/MIF superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G104500 [exp] 135 / 2e-42 AT5G01650 200 / 5e-68 Tautomerase/MIF superfamily protein (.1.2) Potri.016G126500 [exp] 131 / 6e-41 AT5G01650 193 / 2e-65 Tautomerase/MIF superfamily protein (.1.2) Potri.016G126600 [exp] 130 / 1e-40 AT5G01650 216 / 2e-74 Tautomerase/MIF superfamily protein (.1.2) Potri.016G126800 [exp] 120 / 1e-36 AT5G01650 185 / 4e-62 Tautomerase/MIF superfamily protein (.1.2) Potri.006G104600 [exp] 117 / 3e-35 AT5G01650 180 / 3e-60 Tautomerase/MIF superfamily protein (.1.2) Potri.016G126700 [exp] 101 / 5e-29 AT5G01650 164 / 6e-54 Tautomerase/MIF superfamily protein (.1.2) Potri.016G127300 [exp] 97 / 2e-27 AT3G51660 151 / 7e-49 Tautomerase/MIF superfamily protein (.1) Potri.006G104800 [exp] 97 / 2e-27 AT3G51660 151 / 7e-49 Tautomerase/MIF superfamily protein (.1) Potri.006G075100 [exp] 86 / 4e-23 AT5G57170 194 / 7e-66 Tautomerase/MIF superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0082 [flax] [poplar] MIF PF01187 [flax] [poplar] MIF Macrophage migration inhibitory factor (MIF)
Representative CDS sequence Show only first row Show all	>Lus10012223 pacid=23172689 polypeptide=Lus10012223 locus=Lus10012223.g ID=Lus10012223.BGIv1.0 annot-version=v1.0 ATGCCGTGCCTCAGCTTATCGACGAACGTCAACCTGGAAACAATTGACACGCCGGCGTTCCAAAACGCCGCCGCTTCCACCGTTGCCGACATCACCGGAA GACCTGTTGAGTATGTGATGGTTGTTGTAAAGGGCTCTGTTCCGATTATGTTCGGTGGAACGGAGGAGCCAGCTGCTTACGGCGAGCTGCTATCCCTCGG CGTCCCTGACGCCGACAAGAACAAGAGACTCGCAGCCGCCGTCTCGGCGATTGTTGAGGAGAAGTTGTCGGTTCCTAAGGACAGATTCTTCCTCAAGTTC GTTGCGACCAAGGTCGGGTTGTTGACGAGTTAA
AA sequence Show only first row Show all	>Lus10012223 pacid=23172689 polypeptide=Lus10012223 locus=Lus10012223.g ID=Lus10012223.BGIv1.0 annot-version=v1.0 MPCLSLSTNVNLETIDTPAFQNAAASTVADITGRPVEYVMVVVKGSVPIMFGGTEEPAAYGELLSLGVPDADKNKRLAAAVSAIVEEKLSVPKDRFFLKF VATKVGLLTS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G01650			Tautomerase/MIF superfamily pr...		Lus10012223 [exp]	0	1
AT3G13600			calmodulin-binding family prot...		Lus10039178 [exp]	2.0	0.9411
AT3G29635			HXXXD-type acyl-transferase fa...		Lus10005362 [exp]	5.2	0.9466
AT3G09010			Protein kinase superfamily pro...		Lus10040392 [exp]	8.2	0.9112
AT1G17020		ATSRG1, SRG1	senescence-related gene 1 (.1)		Lus10026173 [exp]	12.3	0.9180
AT4G38540			FAD/NAD(P)-binding oxidoreduct...		Lus10019729 [exp]	15.1	0.8703
AT2G29420		GST25, ATGSTU7	GLUTATHIONE S-TRANSFERASE 25, ...		Lus10016469 [exp]	16.4	0.9227
AT3G10980		SAG20, WI12, AT...	PLAC8 family protein (.1)		Lus10012212 [exp]	16.4	0.9244
AT2G26930		CMK, CMEK, ISPE...	PIGMENT DEFECTIVE 277, 4-\(cyt...		Lus10036098 [exp]	16.8	0.9268
AT5G39160			RmlC-like cupins superfamily p...		Lus10042517 [exp]	18.8	0.8874
AT5G23160			unknown protein		Lus10010194 [exp]	19.3	0.9190

Compare expression of checked genes

Lus10012223 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.