Lus10012224 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G38360 298 / 9e-104 PRA1.B4 prenylated RAB acceptor 1.B4 (.1)
AT3G56110 249 / 2e-84 PRA1.B1 prenylated RAB acceptor 1.B1 (.1.2)
AT5G01640 239 / 2e-80 PRA1.B5 prenylated RAB acceptor 1.B5 (.1)
AT2G40380 227 / 1e-75 PRA1.B2 prenylated RAB acceptor 1.B2 (.1)
AT5G05380 223 / 6e-74 PRA1.B3 prenylated RAB acceptor 1.B3 (.1)
AT5G07110 186 / 2e-59 PRA1.B6 prenylated RAB acceptor 1.B6 (.1)
AT4G00005 113 / 5e-32 PRA1 (Prenylated rab acceptor) family protein (.1)
AT1G55190 110 / 2e-30 PRA7, PRA1.F2 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
AT3G13710 103 / 3e-27 PRA1.F4 prenylated RAB acceptor 1.F4 (.1)
AT1G08770 102 / 7e-27 PRA1.E prenylated RAB acceptor 1.E (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002853 372 / 2e-132 AT2G38360 305 / 4e-106 prenylated RAB acceptor 1.B4 (.1)
Lus10017425 251 / 1e-84 AT2G38360 281 / 9e-97 prenylated RAB acceptor 1.B4 (.1)
Lus10007533 249 / 3e-84 AT2G38360 281 / 6e-97 prenylated RAB acceptor 1.B4 (.1)
Lus10009842 247 / 1e-83 AT2G38360 278 / 1e-95 prenylated RAB acceptor 1.B4 (.1)
Lus10042246 243 / 2e-81 AT2G38360 250 / 4e-84 prenylated RAB acceptor 1.B4 (.1)
Lus10026404 236 / 5e-79 AT2G38360 253 / 5e-86 prenylated RAB acceptor 1.B4 (.1)
Lus10022680 224 / 4e-75 AT2G38360 232 / 1e-78 prenylated RAB acceptor 1.B4 (.1)
Lus10014234 145 / 4e-44 AT2G38360 164 / 1e-51 prenylated RAB acceptor 1.B4 (.1)
Lus10034363 117 / 9e-33 AT1G55190 197 / 1e-64 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G126400 261 / 7e-89 AT2G38360 209 / 2e-68 prenylated RAB acceptor 1.B4 (.1)
Potri.008G074000 250 / 7e-85 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2)
Potri.008G074033 250 / 7e-85 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2)
Potri.006G104400 250 / 1e-84 AT2G38360 206 / 5e-67 prenylated RAB acceptor 1.B4 (.1)
Potri.010G183300 249 / 2e-84 AT3G56110 239 / 9e-81 prenylated RAB acceptor 1.B1 (.1.2)
Potri.019G124100 202 / 6e-66 AT5G05380 140 / 8e-42 prenylated RAB acceptor 1.B3 (.1)
Potri.005G219100 135 / 8e-40 AT1G55190 132 / 8e-39 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Potri.002G044000 127 / 1e-36 AT1G55190 130 / 4e-38 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Potri.005G054700 125 / 7e-36 AT1G08770 137 / 1e-40 prenylated RAB acceptor 1.E (.1)
Potri.002G043800 119 / 2e-33 AT1G55190 136 / 1e-40 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03208 PRA1 PRA1 family protein
Representative CDS sequence
>Lus10012224 pacid=23172720 polypeptide=Lus10012224 locus=Lus10012224.g ID=Lus10012224.BGIv1.0 annot-version=v1.0
ATGGCAGCAGCTTCATCCCCTCCAATCCTCCCGATCTCCAACTCACAATCCATCTCCACCAGCACCGCCGAATCCAAGCCACCGATCGCCACCCCAGCCT
TCCGCTCCTTCATTAACAAGATCTCCGACACCGTCCGCAACGGCCTCTCACAGCGCCGTCCCTGGGCAGAGCTCGCCGACCGATCCGCCTTCTCCAAGCC
GGACTCCGTCTCCGACGCTACTCTCCGCCTGCGCAAGAACTACGCCTACTTCCGCGTCAATTACCTCGCCGCCGTCGCCGCGATCCTCGCCTTCTCGTTA
ATCTCCCATCCTTTCTCCCTCCTGCTCCTGATCGGACTCCTCGCTTCGTGGATCTTCCTCTACCTCTTCCGCCCCGCCGATCAGCCACTTGTCATTCTCG
GCCGTACATACACCGACATGGAGACGATCGGGCTCCTCGCCTTGCTCAGCATCGTCGTCGTTTTCCTCACCAGCGTCGGATCGATCCTCATCTCTGGTCT
CATGGTTGGGGCAGCCATCGTGTGTGCGCATGGCGCGTTTAGGGTCCCTGAGGATCTGTTTCTCGACGAGCAGGAGCCTGCCGCCGCTACTGGATTCCTT
TCGTTCCTCGGTGGCGCAGCTTCCAACGTAGCTGCGACTACTGCCGCCCGTGTCTGA
AA sequence
>Lus10012224 pacid=23172720 polypeptide=Lus10012224 locus=Lus10012224.g ID=Lus10012224.BGIv1.0 annot-version=v1.0
MAAASSPPILPISNSQSISTSTAESKPPIATPAFRSFINKISDTVRNGLSQRRPWAELADRSAFSKPDSVSDATLRLRKNYAYFRVNYLAAVAAILAFSL
ISHPFSLLLLIGLLASWIFLYLFRPADQPLVILGRTYTDMETIGLLALLSIVVVFLTSVGSILISGLMVGAAIVCAHGAFRVPEDLFLDEQEPAAATGFL
SFLGGAASNVAATTAARV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G38360 PRA1.B4 prenylated RAB acceptor 1.B4 (... Lus10012224 0 1
AT1G13360 unknown protein Lus10034310 1.4 0.8952
AT5G42050 DCD (Development and Cell Deat... Lus10023059 1.7 0.8948
AT1G08250 AtADT6, ADT6 Arabidopsis thaliana arogenate... Lus10019526 2.0 0.9182
AT3G16510 Calcium-dependent lipid-bindin... Lus10006523 4.2 0.8488
AT2G45760 BAL, BAP2 BON ASSOCIATION PROTEIN 1-LIKE... Lus10036571 4.2 0.8663
Lus10018622 5.5 0.8764
AT3G25780 AOC3, AOC2 allene oxide cyclase 3 (.1) Lus10033535 5.7 0.8563
AT4G14450 ATBET12 unknown protein Lus10021208 7.0 0.8639
AT2G25250 unknown protein Lus10041025 7.5 0.8835
AT4G25380 AtSAP10, SAP10 Arabidopsis thaliana stress-as... Lus10038901 7.9 0.8305

Lus10012224 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.