Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38310 233 / 6e-78 RCAR10, PYL4 regulatory components of ABA receptor 10, PYR1-like 4 (.1) AT2G40330 213 / 4e-70 RCAR9, PYL6 regulatory components of ABA receptor 9, PYR1-like 6 (.1) AT5G05440 201 / 2e-65 RCAR8, PYL5 regulatory component of ABA receptor 8, PYRABACTIN RESISTANCE 1-LIKE 5, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G01360 182 / 2e-58 PYL9, RCAR1 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) AT5G53160 175 / 1e-55 RCAR3, PYL8 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) AT4G01026 176 / 2e-55 RCAR2, PYL7 regulatory components of ABA receptor 2, PYR1-like 7 (.1) AT2G26040 173 / 8e-55 RCAR14, PYL2 regulatory components of ABA receptor 14, PYR1-like 2 (.1) AT4G17870 172 / 4e-54 RCAR11, PYR1 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT4G27920 162 / 1e-50 RCAR4, PYL10 regulatory components of ABA receptor 4, PYR1-like 10 (.1) AT5G45870 159 / 2e-49 RCAR6, PYL12 regulatory components of ABA receptor 6, PYR1-like 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014239 [exp] 263 / 1e-89 AT2G38310 250 / 5e-85 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10022675 [exp] 264 / 4e-89 AT2G38310 249 / 1e-83 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10002861 [exp] 246 / 4e-83 AT2G38310 176 / 7e-56 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10007530 [exp] 223 / 5e-75 AT2G38310 198 / 1e-65 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10007275 [exp] 178 / 1e-56 AT2G40330 183 / 1e-58 regulatory components of ABA receptor 9, PYR1-like 6 (.1) Lus10001059 [exp] 175 / 4e-55 AT5G53160 306 / 1e-107 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10029222 [exp] 172 / 3e-54 AT2G40330 182 / 2e-58 regulatory components of ABA receptor 9, PYR1-like 6 (.1) Lus10026430 [exp] 172 / 5e-54 AT2G26040 264 / 1e-90 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Lus10014929 [exp] 172 / 9e-54 AT5G53160 289 / 2e-100 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G125400 [exp] 280 / 4e-96 AT2G38310 256 / 3e-87 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.006G104100 [exp] 276 / 1e-94 AT2G38310 249 / 2e-84 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.010G183900 [exp] 231 / 3e-77 AT2G40330 243 / 8e-82 regulatory components of ABA receptor 9, PYR1-like 6 (.1) Potri.008G073400 [exp] 225 / 7e-75 AT2G38310 229 / 2e-76 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.006G230600 [exp] 181 / 1e-57 AT2G26040 266 / 6e-92 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Potri.001G142500 [exp] 179 / 9e-57 AT4G17870 286 / 1e-99 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.018G054400 [exp] 178 / 1e-56 AT2G26040 273 / 1e-94 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Potri.015G020500 [exp] 177 / 2e-56 AT5G53160 304 / 7e-107 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.012G000800 [exp] 177 / 2e-56 AT5G53160 303 / 1e-106 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.003G139200 [exp] 176 / 9e-56 AT5G53160 297 / 3e-104 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [flax] [poplar] Bet_v_1_like PF10604 [flax] [poplar] Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Representative CDS sequence Show only first row Show all	>Lus10012231 pacid=23172682 polypeptide=Lus10012231 locus=Lus10012231.g ID=Lus10012231.BGIv1.0 annot-version=v1.0 ATGCCTCCCAATCCTCCCAAATCCTCACTCGGCGTCCACGCCACGGCCACCACTGCCATCTCCTCCACCTCCCCCCANNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCACAGCTC TGCCGCCATCCACCAGATCTCCGCCCCCCTCTCCACTGTCTGGTCGGTAGTCCGGCGGTTCGACAACCCGCAGGCGTACAAGCACTTCGTCAAGAGCTGC CACGTCATCCTCGGTGACGGGGCCGTGGGCACGCTCCGCGAGGTCCACGTGATCTCCGGCCTGCCAGCCGCCAACAGTACGGAGCGGCTCGAGATCCTAG ACGACGAAAGACATGTCATCAGTTTCAGCGTCGTGGGTGGGGACCACAGGCTATCTAACTACCGGTCGGTAACAACTTTACACCCCGCTCCGTCGGGATC CGGCACGGTGGTGGTGGAGTCATACGTCGTCGACACGCCGCCGGGGAACACAAAGGAAGACACGTGCGTGTTCGTCGACACGATCGTAAGGTGTAACCTT CAGTCGTTGGCTCAGATCGCCGAGAACTCCGCGCGGCGGAGCAACAAAACGGCGTCGTTCGCGGCGTAA
AA sequence Show only first row Show all	>Lus10012231 pacid=23172682 polypeptide=Lus10012231 locus=Lus10012231.g ID=Lus10012231.BGIv1.0 annot-version=v1.0 MPPNPPKSSLGVHATATTAISSTSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHSSAAIHQISAPLSTVWSVVRRFDNPQAYKHFVKSC HVILGDGAVGTLREVHVISGLPAANSTERLEILDDERHVISFSVVGGDHRLSNYRSVTTLHPAPSGSGTVVVESYVVDTPPGNTKEDTCVFVDTIVRCNL QSLAQIAENSARRSNKTASFAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38310		RCAR10, PYL4	regulatory components of ABA r...		Lus10012231 [exp]	0	1
AT2G04410			RPM1-interacting protein 4 (RI...		Lus10022524 [exp]	7.0	0.7861
AT2G04410			RPM1-interacting protein 4 (RI...		Lus10016623 [exp]	9.1	0.7628
AT1G08450		AtCRT3, PSL1, E...	PRIORITY IN SWEET LIFE 1, EMS-...		Lus10020222 [exp]	9.3	0.6795
AT2G38310		RCAR10, PYL4	regulatory components of ABA r...		Lus10002861 [exp]	13.9	0.7548
AT1G68360	C2H2ZnF		C2H2 and C2HC zinc fingers sup...		Lus10041427 [exp]	14.7	0.6855
AT5G58060		ATYKT61, ATGP1,...	SNARE-like superfamily protein...		Lus10019047 [exp]	20.3	0.7354
AT5G21090			Leucine-rich repeat (LRR) fami...		Lus10026751 [exp]	25.1	0.7420
AT3G52560		MMZ4 ,UEV1D ,UE...	MMS2 ZWEI HOMOLOGUE 4, ubiquit...		Lus10029415 [exp]	29.4	0.7306
AT2G29700		ATPH1	pleckstrin homologue 1 (.1)		Lus10018222 [exp]	30.2	0.6684
AT1G55190		PRA7, PRA1.F2	PRENYLATED RAB ACCEPTOR 1.F2, ...		Lus10005088 [exp]	32.4	0.7361

Compare expression of checked genes

Lus10012231 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.