Lus10012234 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002866 111 / 4e-33 ND /
Lus10041628 40 / 3e-05 AT5G43150 52 / 3e-10 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G103800 59 / 1e-12 ND /
Potri.016G124300 54 / 1e-10 ND /
Potri.003G187500 42 / 6e-06 AT5G43150 51 / 8e-10 unknown protein
Potri.001G037400 40 / 3e-05 AT5G43150 56 / 1e-11 unknown protein
PFAM info
Representative CDS sequence
>Lus10012234 pacid=23172703 polypeptide=Lus10012234 locus=Lus10012234.g ID=Lus10012234.BGIv1.0 annot-version=v1.0
ATGAACACTCGTTGGAAGCAGAGGCTCCTCCTCTTGAAGCGCAACTCTTTCTCTTCCACCAAGCATGCGATCCTCAAGCTCACTTCCGCCGTCCGATCGC
TCAAACCAAAACCCACCAGCCCCAGATCCACCAGAGGAAGGAAGCAACGAGGGGCGTTGGTGGCGCTACATAAGGATATGGAGTCATGTGGGGAGTATAC
GGATATTCAGGTGATGTGGGAGATGCTGCATTCTGTTAATTGTTCGCCTGGACGACGTCGTGGCGGGAGCCGATCGTCGAGGAAGAAGGTTCCTGGTTGG
AGATCTTGTTTGAGGCCTGTTTGTGTTTGA
AA sequence
>Lus10012234 pacid=23172703 polypeptide=Lus10012234 locus=Lus10012234.g ID=Lus10012234.BGIv1.0 annot-version=v1.0
MNTRWKQRLLLLKRNSFSSTKHAILKLTSAVRSLKPKPTSPRSTRGRKQRGALVALHKDMESCGEYTDIQVMWEMLHSVNCSPGRRRGGSRSSRKKVPGW
RSCLRPVCV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10012234 0 1
AT3G45600 TET3 tetraspanin3 (.1) Lus10038473 19.3 0.6474
AT1G77850 ARF ARF17 auxin response factor 17 (.1) Lus10024753 19.8 0.6623
AT3G27970 Exonuclease family protein (.1... Lus10008787 33.1 0.6468
AT1G77850 ARF ARF17 auxin response factor 17 (.1) Lus10024754 41.7 0.6085
AT1G70630 Nucleotide-diphospho-sugar tra... Lus10036861 43.1 0.5867
AT1G05500 SYT5, NTMCTYPE2... synaptotagmin 5, ARABIDOPSIS T... Lus10038117 72.2 0.6016
AT4G17050 UGLYAH ureidoglycine aminohydrolase (... Lus10040144 123.3 0.5547
AT2G38610 RNA-binding KH domain-containi... Lus10003241 138.8 0.5466
AT1G23790 Plant protein of unknown funct... Lus10030870 208.5 0.5065

Lus10012234 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.