Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G35030 80 / 1e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G42920 75 / 4e-17 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT5G65570 75 / 7e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G02980 73 / 3e-16 OTP85 ORGANELLE TRANSCRIPT PROCESSING 85, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G13600 72 / 7e-16 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G22070 71 / 2e-15 pentatricopeptide (PPR) repeat-containing protein (.1) AT2G46050 71 / 2e-15 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT4G14050 70 / 4e-15 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G55740 69 / 5e-15 CRR21 chlororespiratory reduction 21, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G77170 68 / 2e-14 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019213 [exp] 156 / 4e-46 AT2G21090 376 / 2e-123 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10020743 [exp] 76 / 3e-17 AT1G04840 771 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10030581 [exp] 76 / 5e-17 AT1G68930 910 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10015898 [exp] 73 / 3e-16 AT2G13600 899 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10009269 [exp] 72 / 5e-16 AT2G13600 874 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10005064 [exp] 72 / 7e-16 AT2G21090 513 / 2e-179 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10029793 [exp] 71 / 2e-15 AT1G04840 756 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10030908 [exp] 70 / 4e-15 AT1G68930 928 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10027455 [exp] 69 / 6e-15 AT3G29230 324 / 4e-102 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G316500 [exp] 79 / 2e-18 AT1G04840 728 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.012G140400 [exp] 76 / 3e-17 AT3G29230 398 / 2e-132 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G239600 [exp] 74 / 1e-16 AT5G59200 694 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 80, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.012G041200 [exp] 74 / 2e-16 AT5G16860 1083 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.017G001000 [exp] 73 / 2e-16 AT4G21065 793 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.005G202600 [exp] 72 / 6e-16 AT2G42920 660 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.001G369900 [exp] 71 / 2e-15 AT5G66520 512 / 2e-175 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.010G136200 [exp] 70 / 3e-15 AT1G68930 997 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Potri.001G354400 [exp] 70 / 4e-15 AT5G46460 863 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.009G113500 [exp] 69 / 4e-15 AT3G18840 772 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10012235 pacid=23172712 polypeptide=Lus10012235 locus=Lus10012235.g ID=Lus10012235.BGIv1.0 annot-version=v1.0 ATGAATGAAAGGGATATTCTGTCCCGGACGTTGATGGTGGCTGCCTGTACTCGAGCATCCATACTGGATGATGCTATTGGTCTCTTTAAACAGATGCGAT ATAGGAACACTGTTGCTTGGACTAGCTTGATGGCTGGTTTCGCACAAAATGGCCAGAGTGAAAGAACAATGGATATCTTTAAGCAAATGTTGGAGGATGG AGTTGAGCCGAGTGGTTTTACGTTTGTAACTCTTCTTAGTGCATGTGCTGATCTAGCACGTTTGTATAAAAGTAAGCAGGCGATATGGGATCTTCCAAGA GATTGTTCGACGGAATGGTAA
AA sequence Show only first row Show all	>Lus10012235 pacid=23172712 polypeptide=Lus10012235 locus=Lus10012235.g ID=Lus10012235.BGIv1.0 annot-version=v1.0 MNERDILSRTLMVAACTRASILDDAIGLFKQMRYRNTVAWTSLMAGFAQNGQSERTMDIFKQMLEDGVEPSGFTFVTLLSACADLARLYKSKQAIWDLPR DCSTEW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G42920			Pentatricopeptide repeat (PPR-...		Lus10012235 [exp]	0	1
AT4G04720		CPK21	calcium-dependent protein kina...		Lus10020046 [exp]	1.7	0.8804
AT5G17680			disease resistance protein (TI...		Lus10043227 [exp]	3.5	0.8633
AT4G04720		CPK21	calcium-dependent protein kina...		Lus10006777 [exp]	4.5	0.8707
AT4G38900	bZIP	AtbZIP29	Basic-leucine zipper (bZIP) tr...		Lus10012390 [exp]	4.9	0.8604
AT1G59820		ALA3	aminophospholipid ATPase 3 (.1...		Lus10010737 [exp]	5.3	0.8492
AT3G12490		ATCYS6, ATCYSB	ARABIDOPSIS THALIANA PHYTOCYST...		Lus10008702 [exp]	5.5	0.8501
AT3G51120			DNA binding;zinc ion binding;n...		Lus10014272 [exp]	8.1	0.8531
AT1G54130		AT-RSH3, RSH3, ...	RELA/SPOT homolog 3 (.1)		Lus10008755 [exp]	8.5	0.8127
AT4G24200			Transcription elongation facto...		Lus10017630 [exp]	10.8	0.8236
AT5G66050			Wound-responsive family protei...		Lus10041852 [exp]	12.6	0.7836

Compare expression of checked genes

Lus10012235 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.