Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G20693 95 / 6e-26 HMGBETA1, NFD2, NFD02, HMGB2 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 2, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 02, HIGH MOBILITY GROUP BETA 1, high mobility group B2 (.1.2.3) AT1G20696 91 / 2e-24 NFD3, NFD03, HMGB3 high mobility group B3 (.1.2.3) AT2G17560 71 / 1e-16 NFD4, NFD04, HMGB4 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR D4, high mobility group B4 (.1.2.3) AT3G51880 66 / 1e-14 AtHMGB1, NFD1, HMGB1 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR D1, high mobility group B1 (.1.2.3.4) AT4G35570 63 / 8e-14 NFD5, NFD05, HMGD, HMGB5 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR 5, high mobility group B5 (.1) AT2G34450 57 / 4e-11 HMG-box (high mobility group) DNA-binding family protein (.1), HMG-box (high mobility group) DNA-binding family protein (.2) AT5G23420 53 / 3e-09 HMGB6 high-mobility group box 6 (.1.2) AT4G23800 40 / 9e-05 3xHMG-box2, AT4G23800 3xHigh Mobility Group-box2, HMG (high mobility group) box protein (.1), HMG (high mobility group) box protein (.2) AT4G11080 40 / 0.0001 3xHMG-box1 3xHigh Mobility Group-box1, HMG (high mobility group) box protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016025 [exp] 115 / 3e-34 AT1G20693 192 / 7e-64 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 2, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 02, HIGH MOBILITY GROUP BETA 1, high mobility group B2 (.1.2.3) Lus10012250 [exp] 115 / 7e-32 AT1G20696 189 / 3e-59 high mobility group B3 (.1.2.3) Lus10030738 [exp] 92 / 2e-24 AT1G20693 185 / 7e-61 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 2, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 02, HIGH MOBILITY GROUP BETA 1, high mobility group B2 (.1.2.3) Lus10013219 [exp] 76 / 1e-18 AT1G20693 165 / 2e-53 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 2, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 02, HIGH MOBILITY GROUP BETA 1, high mobility group B2 (.1.2.3) Lus10040192 [exp] 70 / 6e-16 AT3G51880 140 / 1e-42 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR D1, high mobility group B1 (.1.2.3.4) Lus10028298 [exp] 70 / 9e-16 AT3G51880 134 / 6e-40 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR D1, high mobility group B1 (.1.2.3.4) Lus10035511 [exp] 61 / 3e-12 AT3G51880 152 / 2e-46 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR D1, high mobility group B1 (.1.2.3.4) Lus10041009 [exp] 55 / 7e-10 AT5G23420 178 / 1e-55 high-mobility group box 6 (.1.2) Lus10015268 [exp] 54 / 3e-09 AT2G13620 507 / 1e-166 CATION/H+ EXCHANGER 15, cation/hydrogen exchanger 15 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G252600 [exp] 92 / 5e-25 AT1G20696 147 / 7e-46 high mobility group B3 (.1.2.3) Potri.002G009000 [exp] 89 / 8e-24 AT1G20696 146 / 8e-46 high mobility group B3 (.1.2.3) Potri.005G101400 [exp] 83 / 3e-21 AT1G20696 112 / 2e-32 high mobility group B3 (.1.2.3) Potri.010G189900 [exp] 68 / 4e-15 AT3G51880 129 / 3e-38 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR D1, high mobility group B1 (.1.2.3.4) Potri.008G067400 [exp] 65 / 3e-14 AT3G51880 100 / 4e-27 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR D1, high mobility group B1 (.1.2.3.4) Potri.004G131400 [exp] 58 / 1e-11 AT2G34450 132 / 6e-40 HMG-box (high mobility group) DNA-binding family protein (.1), HMG-box (high mobility group) DNA-binding family protein (.2) Potri.007G000900 [exp] 55 / 3e-10 AT5G23420 156 / 8e-48 high-mobility group box 6 (.1.2) Potri.001G093700 [exp] 40 / 0.0002 AT4G11080 325 / 2e-106 3xHigh Mobility Group-box1, HMG (high mobility group) box protein (.1) Potri.003G138000 [exp] 38 / 0.0005 AT4G11080 302 / 1e-97 3xHigh Mobility Group-box1, HMG (high mobility group) box protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0114 [flax] [poplar] HMG-box PF00505 [flax] [poplar] HMG_box HMG (high mobility group) box
Representative CDS sequence Show only first row Show all	>Lus10012252 pacid=23172680 polypeptide=Lus10012252 locus=Lus10012252.g ID=Lus10012252.BGIv1.0 annot-version=v1.0 ATGAAAGGAGGAAAATCAAAGTCGGATGCCAAGAATACCAAGCTGTCCGTGACGAAGAAGCCTGCTAAGCCGACGAAAAAGGCGGCGAAGGCAGCCAAGG ACCCTAACAAACCGAAGAGGCCTCCAAGCGCCTTCTTCGTTTTCATGGAGGATTTTAGAGAGCAGTTTAAGAAAGAGCATCCTAAGAATAAATCAGTGGC TGCTGTTGGGAAAGCAGCTGGAGAGAAATGGAAGTCATTGACTGACGAAGAGAAACAACCCTACATCGCCAAAGCTGAGAAGAGGAAGGCTGAATATGAG AAGAAAATGAAGGCCTACAACAAAGGAGAGGAGGAGGATGATGAGGAGTAG
AA sequence Show only first row Show all	>Lus10012252 pacid=23172680 polypeptide=Lus10012252 locus=Lus10012252.g ID=Lus10012252.BGIv1.0 annot-version=v1.0 MKGGKSKSDAKNTKLSVTKKPAKPTKKAAKAAKDPNKPKRPPSAFFVFMEDFREQFKKEHPKNKSVAAVGKAAGEKWKSLTDEEKQPYIAKAEKRKAEYE KKMKAYNKGEEEDDEE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G20693		HMGBETA1, NFD2,...	NUCLEOSOME/CHROMATIN ASSEMBLY ...		Lus10012252 [exp]	0	1
AT1G20693		HMGBETA1, NFD2,...	NUCLEOSOME/CHROMATIN ASSEMBLY ...		Lus10016025 [exp]	1.0	0.9518
AT3G51880		AtHMGB1, NFD1, ...	NUCLEOSOME/CHROMATIN ASSEMBLY ...		Lus10028298 [exp]	2.0	0.8901
AT5G57910			unknown protein		Lus10022161 [exp]	4.0	0.8434
AT1G75220		AtERDL6	ERD6-like 6, Major facilitator...		Lus10001656 [exp]	4.9	0.8303
AT1G55170			unknown protein		Lus10034321 [exp]	6.7	0.8214
AT3G46980		PHT4;3	phosphate transporter 4;3 (.1....		Lus10018203 [exp]	7.7	0.8086
AT2G02390		GST18, ATGSTZ1	GLUTATHIONE S-TRANSFERASE 18, ...		Lus10005367 [exp]	7.7	0.8381
AT3G18500			DNAse I-like superfamily prote...		Lus10036357 [exp]	9.9	0.8291
AT5G27560			Domain of unknown function (DU...		Lus10029929 [exp]	11.0	0.8471
AT5G45360			F-box family protein (.1)		Lus10007767 [exp]	12.1	0.7986

Compare expression of checked genes

Lus10012252 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.