Lus10012271 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G55460 151 / 7e-46 C2H2ZnF DNA/RNA-binding protein Kin17, conserved region (.1)
AT5G51795 148 / 3e-45 DNA/RNA-binding protein Kin17, conserved region (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001697 167 / 8e-53 AT1G55460 408 / 3e-142 DNA/RNA-binding protein Kin17, conserved region (.1)
Lus10005161 167 / 4e-52 AT1G55460 596 / 0.0 DNA/RNA-binding protein Kin17, conserved region (.1)
Lus10039439 41 / 3e-05 ND 45 / 1e-05
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G204900 155 / 1e-47 AT1G55460 561 / 0.0 DNA/RNA-binding protein Kin17, conserved region (.1)
Potri.008G055300 155 / 1e-47 AT1G55460 546 / 0.0 DNA/RNA-binding protein Kin17, conserved region (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0123 HTH PF10357 Kin17_mid Domain of Kin17 curved DNA-binding protein
Representative CDS sequence
>Lus10012271 pacid=23172705 polypeptide=Lus10012271 locus=Lus10012271.g ID=Lus10012271.BGIv1.0 annot-version=v1.0
ATGGTACTCCAGATGTGTGAGAAGCAGTGCAGGGACGAGAACAGATTCAAGTGCCACTGCATGAGCGAGAGTCATCAGCGGCAGACGCTAATCTTCGGTC
AAAACCCTAACCGAGTCGTCGAGGGCTACACGGAGGAGTTCGAGACCGGATTCCTCGACCGCATGAAGCACAGCCATCGCTTCTCTCGCCTTGCCGCCAC
CGTCGTCTACAACGAGTACATCCACGACCGCCATCACGTCCATATGAACTCCACCTAG
AA sequence
>Lus10012271 pacid=23172705 polypeptide=Lus10012271 locus=Lus10012271.g ID=Lus10012271.BGIv1.0 annot-version=v1.0
MVLQMCEKQCRDENRFKCHCMSESHQRQTLIFGQNPNRVVEGYTEEFETGFLDRMKHSHRFSRLAATVVYNEYIHDRHHVHMNST

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G55460 C2H2ZnF DNA/RNA-binding protein Kin17,... Lus10012271 0 1
Lus10035252 1.0 0.7369
AT3G53900 UPP, PYRR PYRIMIDINE R, uracil phosphori... Lus10012654 12.8 0.7292
AT4G17150 alpha/beta-Hydrolases superfam... Lus10038733 14.1 0.6665
AT3G60750 Transketolase (.1.2) Lus10007839 14.1 0.6063
Lus10017083 16.7 0.5887
AT5G19630 alpha/beta-Hydrolases superfam... Lus10004187 18.5 0.6171
AT2G34790 MEE23, EDA28 MATERNAL EFFECT EMBRYO ARREST ... Lus10023363 19.1 0.6783
AT5G44440 FAD-binding Berberine family p... Lus10003646 19.2 0.6696
AT5G03300 ADK2 adenosine kinase 2 (.1) Lus10023197 22.1 0.5636
AT5G04850 VPS60.2 SNF7 family protein (.1.2) Lus10043454 24.0 0.6414

Lus10012271 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.