Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G55460 41 / 1e-05 C2H2ZnF DNA/RNA-binding protein Kin17, conserved region (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001697 [exp] 94 / 1e-24 AT1G55460 408 / 3e-142 DNA/RNA-binding protein Kin17, conserved region (.1) Lus10005161 [exp] 94 / 3e-24 AT1G55460 596 / 0.0 DNA/RNA-binding protein Kin17, conserved region (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G055300 [exp] 70 / 8e-16 AT1G55460 546 / 0.0 DNA/RNA-binding protein Kin17, conserved region (.1) Potri.010G204900 [exp] 63 / 3e-13 AT1G55460 561 / 0.0 DNA/RNA-binding protein Kin17, conserved region (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012272 pacid=23172653 polypeptide=Lus10012272 locus=Lus10012272.g ID=Lus10012272.BGIv1.0 annot-version=v1.0 ATGTTGAAGGAGAAGATGAAGAACAAGAAGGTTAGGGCTGATTTGGTGGACGAGGATAGGCAGGAGAGGGAAATCCTCAAGCAGGTTGACAAGGCAGAGC AGTTGTTGAAAAGAGAGGGTGACGGTGTTGATGTTGTGGAGGAGCCGCCGACGAAGGAATTGAAACTTGATGCTCAAGGGGTTAAGACTGGATTTCAACT GAGTAGCAACAGTAGAGGTGAGAGTTCGAGTTGA
AA sequence Show only first row Show all	>Lus10012272 pacid=23172653 polypeptide=Lus10012272 locus=Lus10012272.g ID=Lus10012272.BGIv1.0 annot-version=v1.0 MLKEKMKNKKVRADLVDEDRQEREILKQVDKAEQLLKREGDGVDVVEEPPTKELKLDAQGVKTGFQLSSNSRGESSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G55460	C2H2ZnF		DNA/RNA-binding protein Kin17,...		Lus10012272 [exp]	0	1
AT2G27990	HD	PNF, BLH8	POUND-FOOLISH, BEL1-like homeo...		Lus10040256 [exp]	14.0	0.8859
AT5G09550			GDP dissociation inhibitor fam...		Lus10035634 [exp]	16.3	0.8821
AT2G44380			Cysteine/Histidine-rich C1 dom...		Lus10037470 [exp]	16.9	0.8392
AT4G22320			unknown protein		Lus10043179 [exp]	19.0	0.8614
					Lus10037567 [exp]	22.6	0.8755
AT1G07410		ATRAB-A2B, AtRA...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Lus10004687 [exp]	29.3	0.8728
AT1G47790			F-box and associated interacti...		Lus10031533 [exp]	31.6	0.8658
					Lus10027902 [exp]	32.1	0.8693
AT5G44440			FAD-binding Berberine family p...		Lus10003646 [exp]	32.4	0.7772
AT2G41830			Uncharacterized protein (.1)		Lus10019717 [exp]	35.0	0.7645

Compare expression of checked genes

Lus10012272 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.