Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G76185 73 / 4e-18 unknown protein AT1G20460 73 / 7e-18 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034569 [exp] 74 / 4e-18 AT1G20460 154 / 5e-50 unknown protein Lus10021826 [exp] 48 / 1e-08 AT1G20460 52 / 2e-10 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G013000 [exp] 84 / 3e-22 AT1G20460 103 / 4e-30 unknown protein Potri.005G248300 [exp] 76 / 5e-19 AT1G20460 101 / 2e-29 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012282 pacid=23172721 polypeptide=Lus10012282 locus=Lus10012282.g ID=Lus10012282.BGIv1.0 annot-version=v1.0 ATGATCACGAGATCGAATCTGGCCGAGCAGTTGAGGGAATACCAGATTCGATCCAAGCATGACTGGGCCTCCGTTAACTTCTTCACTTCAACGTCGAATA CTTTCAGCCATTCGAGGGTTGATGTGGTCATATTCGTCATATGGGAACTTGTCGTTCTTGCCTTCCTAGTGTTTTCGGCCGTGTCTTTGTATTTCAGGCA CATGAGACTTGCCTTCATATTAGTCTGCGTTACATTACTGTTGGTCCTGTGCATGAAACTAACAAAGCAAGTGAGGTTGGCTAGGAAGAAGAAACGGAGA ATGCTTCTTCCTTTATCCATGTAA
AA sequence Show only first row Show all	>Lus10012282 pacid=23172721 polypeptide=Lus10012282 locus=Lus10012282.g ID=Lus10012282.BGIv1.0 annot-version=v1.0 MITRSNLAEQLREYQIRSKHDWASVNFFTSTSNTFSHSRVDVVIFVIWELVVLAFLVFSAVSLYFRHMRLAFILVCVTLLLVLCMKLTKQVRLARKKKRR MLLPLSM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G20460			unknown protein		Lus10012282 [exp]	0	1
AT2G24550			unknown protein		Lus10026939 [exp]	3.7	0.9500
AT1G13570			F-box/RNI-like superfamily pro...		Lus10030920 [exp]	4.6	0.9413
AT4G19160			unknown protein		Lus10025855 [exp]	9.6	0.9438
AT5G27320		ATGID1C, GID1C	GA INSENSITIVE DWARF1C, alpha/...		Lus10002254 [exp]	10.1	0.9340
AT2G10950			BSD domain-containing protein ...		Lus10027706 [exp]	12.0	0.9395
AT3G01640		ATGLCAK	ARABIDOPSIS THALIANA GLUCURONO...		Lus10022282 [exp]	13.0	0.9431
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10018702 [exp]	13.4	0.9422
AT4G37880			LisH/CRA/RING-U-box domains-co...		Lus10019837 [exp]	16.6	0.9381
AT2G45240		MAP1A	methionine aminopeptidase 1A (...		Lus10021657 [exp]	18.2	0.9056
AT1G48300			unknown protein		Lus10038034 [exp]	19.1	0.9354

Compare expression of checked genes

Lus10012282 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.