Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G21326 50 / 1e-08 VQ motif-containing protein (.1) AT1G68450 48 / 3e-08 PDE337 PIGMENT DEFECTIVE 337, VQ motif-containing protein (.1) AT3G18360 44 / 9e-07 VQ motif-containing protein (.1) AT1G21320 44 / 2e-06 nucleotide binding;nucleic acid binding (.1.2) AT3G18690 40 / 3e-05 MKS1 MAP kinase substrate 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009033 [exp] 47 / 1e-07 AT3G18360 110 / 5e-29 VQ motif-containing protein (.1) Lus10042794 [exp] 45 / 3e-07 AT1G21326 74 / 9e-17 VQ motif-containing protein (.1) Lus10029768 [exp] 45 / 5e-07 AT1G21326 79 / 4e-18 VQ motif-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G199300 [exp] 62 / 4e-14 AT1G68450 60 / 1e-12 PIGMENT DEFECTIVE 337, VQ motif-containing protein (.1) Potri.015G046600 [exp] 49 / 1e-08 AT3G18360 81 / 2e-18 VQ motif-containing protein (.1) Potri.012G055900 [exp] 44 / 7e-07 AT3G18360 73 / 2e-15 VQ motif-containing protein (.1) Potri.005G057800 [exp] 42 / 4e-06 AT3G18690 124 / 2e-35 MAP kinase substrate 1 (.1) Potri.005G189300 [exp] 41 / 9e-06 AT1G21326 75 / 4e-16 VQ motif-containing protein (.1) Potri.002G070600 [exp] 41 / 1e-05 AT1G21326 76 / 3e-16 VQ motif-containing protein (.1) Potri.010G123700 [exp] 41 / 1e-05 AT1G68450 64 / 9e-13 PIGMENT DEFECTIVE 337, VQ motif-containing protein (.1) Potri.007G110100 [exp] 37 / 0.0002 AT3G18690 119 / 3e-33 MAP kinase substrate 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05678 [flax] [poplar] VQ VQ motif
Representative CDS sequence Show only first row Show all	>Lus10012286 pacid=23172710 polypeptide=Lus10012286 locus=Lus10012286.g ID=Lus10012286.BGIv1.0 annot-version=v1.0 ATGGAGGTTTCGGCCGGCAAGCAGCAGTTCAGTGACGATCACGGCGGACGTCCGAAGCCTCCGCCGCTAAACGTCACCAACAACAGGTCATGCAACGGCC GGCGGCGACCAGGTCCTGTCATCGTCTACGAGAAATCGCCGGACATCATCCACGTGGAACCCCAGGAGTTCATGGGACTCGTCCAACGCCTCACCGGCAA ACAAGACCAGAGTACCTAG
AA sequence Show only first row Show all	>Lus10012286 pacid=23172710 polypeptide=Lus10012286 locus=Lus10012286.g ID=Lus10012286.BGIv1.0 annot-version=v1.0 MEVSAGKQQFSDDHGGRPKPPPLNVTNNRSCNGRRRPGPVIVYEKSPDIIHVEPQEFMGLVQRLTGKQDQST

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G21326			VQ motif-containing protein (....		Lus10012286 [exp]	0	1
AT4G17030		ATHEXPBETA3.1, ...	expansin-like B1 (.1)		Lus10030931 [exp]	1.0	0.9969
AT1G17860			Kunitz family trypsin and prot...		Lus10026357 [exp]	1.4	0.9967
AT1G17860			Kunitz family trypsin and prot...		Lus10039163 [exp]	2.4	0.9917
AT5G09360		LAC14	laccase 14 (.1)		Lus10006157 [exp]	4.2	0.9876
AT5G49630		AAP6	amino acid permease 6 (.1)		Lus10007235 [exp]	4.9	0.9833
AT2G19070		SHT	spermidine hydroxycinnamoyl tr...		Lus10005358 [exp]	5.3	0.9792
AT1G17860			Kunitz family trypsin and prot...		Lus10042301 [exp]	5.9	0.9869
					Lus10043316 [exp]	6.6	0.9903
AT4G02780		ATCPS1, ABC33, ...	GA REQUIRING 1, CPP synthase, ...		Lus10042593 [exp]	7.3	0.9820
					Lus10030774 [exp]	8.4	0.9679

Compare expression of checked genes

Lus10012286 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.