Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016080 [exp] 112 / 9e-31 AT3G07570 397 / 9e-138 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1) Lus10001180 [exp] 53 / 2e-09 AT3G07570 377 / 5e-130 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012304 pacid=23176777 polypeptide=Lus10012304 locus=Lus10012304.g ID=Lus10012304.BGIv1.0 annot-version=v1.0 ATGCTCATCAAACGCCGCCCTCTCTTCCCTCTCCGGCTTGCCCTTCGACCCTTCCTCCCTCACCCAGTGCCTCTCACCCTGGATCGCCCACAACTACATC CTCCGATACTCGCAAGAATCGTTGAATGTGTGGAACTTCCTGCTCTCGGCGAGGGACGCCAACTCCTAAGTGGCGGTGGGGTTCTCGACGGACGGCCAGA TGGTGGGGTCCAGCGCCTTGGTGGGGTGGATGCCGGCGGACGGAAGCGGCGGGCAGGTGAAGCAGTACTACCTAAGCGGGCAGACGCCCGGGCAGGTGGT CCCTGA
AA sequence Show only first row Show all	>Lus10012304 pacid=23176777 polypeptide=Lus10012304 locus=Lus10012304.g ID=Lus10012304.BGIv1.0 annot-version=v1.0 MLIKRRPLFPLRLALRPFLPHPVPLTLDRPQLHPPILARIVECVELPALGEGRQLLSGGGVLDGRPDGGVQRLGGVDAGGRKRRAGEAVLPKRADARAGG P

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10012304 [exp]	0	1
AT5G27730			Protein of unknown function (D...		Lus10022615 [exp]	3.5	0.9341
AT1G62560		FMOGS-OX3 ,FMO ...	flavin-monooxygenase glucosino...		Lus10024609 [exp]	5.1	0.9368
AT4G35783		RTFL6, DVL17	DEVIL 17, ROTUNDIFOLIA like 6 ...		Lus10041846 [exp]	8.1	0.8938
AT2G40260	GARP		Homeodomain-like superfamily p...		Lus10040945 [exp]	12.2	0.9343
AT4G21690		ATGA3OX3	ARABIDOPSIS THALIANA GIBBERELL...		Lus10008100 [exp]	13.0	0.9110
AT1G68710			ATPase E1-E2 type family prote...		Lus10035068 [exp]	13.7	0.9308
AT4G39780	AP2_ERF		Integrase-type DNA-binding sup...		Lus10000582 [exp]	15.2	0.9152
AT2G45630			D-isomer specific 2-hydroxyaci...		Lus10036536 [exp]	24.1	0.9251
AT1G61590			Protein kinase superfamily pro...		Lus10034757 [exp]	24.3	0.9286
AT1G13590		ATPSK1	phytosulfokine 1 precursor (.1...		Lus10030916 [exp]	27.7	0.8856

Compare expression of checked genes

Lus10012304 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.