Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G35740 163 / 3e-53 Carbohydrate-binding X8 domain superfamily protein (.1) AT2G04910 137 / 4e-43 Carbohydrate-binding X8 domain superfamily protein (.1.2) AT3G13560 103 / 8e-27 O-Glycosyl hydrolases family 17 protein (.1.2.3) AT4G29360 100 / 5e-26 O-Glycosyl hydrolases family 17 protein (.1.2) AT1G11820 99 / 3e-25 O-Glycosyl hydrolases family 17 protein (.1.2) AT1G29380 94 / 3e-24 Carbohydrate-binding X8 domain superfamily protein (.1) AT5G67460 92 / 2e-23 O-Glycosyl hydrolases family 17 protein (.1) AT3G58100 89 / 3e-23 PDCB5 plasmodesmata callose-binding protein 5 (.1) AT4G05430 87 / 4e-23 Carbohydrate-binding X8 domain superfamily protein (.1) AT2G30933 89 / 6e-23 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001167 [exp] 169 / 2e-55 AT5G35740 150 / 3e-48 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10039059 [exp] 148 / 5e-47 AT5G35740 157 / 3e-50 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10038801 [exp] 139 / 6e-44 AT5G35740 146 / 1e-46 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10001740 [exp] 125 / 1e-38 AT5G35740 111 / 2e-33 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10015151 [exp] 99 / 2e-25 AT2G05790 731 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10031456 [exp] 99 / 2e-25 AT1G11820 796 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10004546 [exp] 97 / 4e-25 AT1G29380 175 / 2e-52 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10004600 [exp] 97 / 5e-25 AT1G29380 168 / 7e-50 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10039907 [exp] 93 / 7e-25 AT3G58100 158 / 1e-49 plasmodesmata callose-binding protein 5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G164600 [exp] 187 / 8e-63 AT5G35740 179 / 8e-60 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.006G016800 [exp] 169 / 8e-56 AT5G35740 156 / 1e-50 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.001G006500 [exp] 107 / 2e-28 AT3G13560 632 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2.3) Potri.003G218500 [exp] 104 / 2e-27 AT3G13560 594 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2.3) Potri.011G006100 [exp] 99 / 2e-25 AT1G11820 805 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.011G078500 [exp] 97 / 2e-25 AT1G29380 154 / 1e-44 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.002G059600 [exp] 95 / 8e-25 AT2G30933 164 / 5e-50 Carbohydrate-binding X8 domain superfamily protein (.1.2) Potri.004G010500 [exp] 96 / 3e-24 AT1G11820 794 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.001G353400 [exp] 94 / 5e-24 AT1G29380 144 / 1e-40 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.017G055700 [exp] 90 / 1e-23 AT4G13600 152 / 3e-46 Carbohydrate-binding X8 domain superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07983 [flax] [poplar] X8 X8 domain
Representative CDS sequence Show only first row Show all	>Lus10012324 pacid=23176804 polypeptide=Lus10012324 locus=Lus10012324.g ID=Lus10012324.BGIv1.0 annot-version=v1.0 ATGCAATCTTTATACCAGAGCCTAGCAGTGGTTGCCTTGCTGCTGCTTGTTTTTTTTGTCGGATCAGATGGGGAGATGGAGCAATGGTGTATTGCGGATG AACAAACACCAGATGGGGAGTTGCAGGCAGCCATTGATTGGGCTTGTGGGAAAGGAGGAGCGAATTGCAGCAAGATTCAGATGAACCAGCCTTGTTATTT GCCCAACACAAAGAAGGACCACGCATCTTACGCCTTCAACAACTACTTCCAGAAGTTCAAGCACAAGGGCGGATCTTGTTACTTCAATGGCGCCGCCATT GTTACTGACCTTGATCCCAGCCATAGCTCTTGCCAGTATGAGTACTCCCCCTGA
AA sequence Show only first row Show all	>Lus10012324 pacid=23176804 polypeptide=Lus10012324 locus=Lus10012324.g ID=Lus10012324.BGIv1.0 annot-version=v1.0 MQSLYQSLAVVALLLLVFFVGSDGEMEQWCIADEQTPDGELQAAIDWACGKGGANCSKIQMNQPCYLPNTKKDHASYAFNNYFQKFKHKGGSCYFNGAAI VTDLDPSHSSCQYEYSP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G35740			Carbohydrate-binding X8 domain...		Lus10012324 [exp]	0	1
AT1G04040			HAD superfamily, subfamily III...		Lus10011774 [exp]	1.7	0.9394
AT1G03220			Eukaryotic aspartyl protease f...		Lus10021938 [exp]	2.0	0.9348
AT3G11980		FAR2, MS2	MALE STERILITY 2, FATTY ACID R...		Lus10016208 [exp]	3.2	0.9256
AT4G09600		GASA3	GAST1 protein homolog 3 (.1)		Lus10025962 [exp]	4.2	0.9323
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10003048 [exp]	5.3	0.9166
AT2G17080			Arabidopsis protein of unknown...		Lus10014446 [exp]	5.5	0.9183
AT5G19730			Pectin lyase-like superfamily ...		Lus10041815 [exp]	5.7	0.9162
AT2G03350			Protein of unknown function, D...		Lus10037126 [exp]	6.6	0.9316
AT5G15290		CASP5	Casparian strip membrane domai...		Lus10015375 [exp]	8.8	0.9037
AT5G05460		AtENGase85A	Endo-beta-N-acetyglucosaminida...		Lus10017430 [exp]	13.3	0.8689

Compare expression of checked genes

Lus10012324 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.