Lus10012326 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006371 42 / 4e-05 AT5G26730 140 / 5e-41 Fasciclin-like arabinogalactan family protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10012326 pacid=23176787 polypeptide=Lus10012326 locus=Lus10012326.g ID=Lus10012326.BGIv1.0 annot-version=v1.0
ATGCCCGTCCTACACTTATTTGCTTCCAACGTCTCCAACATCGCCAACGTCTCCAACATCGCGAACGTCGCCATCATTGTTGCTGCTATACCTATAATCA
CCGTCGTTGCTACACCCCTACCCCCTTCCAAGAAGCACGACCAGGACATCATCCCTGCATCACCAACCGGTCAGTCAAAAGCGACCGATGCCGCCATTAA
GTTTGATGACGCTGACTCTTCTCCCCCTACCTCGGCATCTCTCGTAACGCTCGACCTCAGCCTCGATGTTCGTACTCCAATGTCGCCGGTGTCTGCGAAT
TCTGCCTCTGATGCAGGATCTTCATCGTCCCCGCATCTGGGTGATATCCCTGCACCGCACTCATCGTTAAAAATTGTAACCTTGTAA
AA sequence
>Lus10012326 pacid=23176787 polypeptide=Lus10012326 locus=Lus10012326.g ID=Lus10012326.BGIv1.0 annot-version=v1.0
MPVLHLFASNVSNIANVSNIANVAIIVAAIPIITVVATPLPPSKKHDQDIIPASPTGQSKATDAAIKFDDADSSPPTSASLVTLDLSLDVRTPMSPVSAN
SASDAGSSSSPHLGDIPAPHSSLKIVTL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10012326 0 1
Lus10033874 2.2 0.7664
AT4G34131 UGT73B3 UDP-glucosyl transferase 73B3 ... Lus10014079 5.0 0.6156
AT4G26120 Ankyrin repeat family protein ... Lus10024842 8.8 0.6498
Lus10012084 13.6 0.6284
Lus10013877 14.5 0.6127
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Lus10028896 15.2 0.6332
AT2G44480 BGLU17 beta glucosidase 17 (.1.2) Lus10031808 21.2 0.6076
AT3G55150 ATEXO70H1 exocyst subunit exo70 family p... Lus10023452 24.3 0.5961
Lus10013529 25.7 0.5722
AT2G04040 ATDTX1 detoxification 1, MATE efflux ... Lus10009132 26.0 0.5789

Lus10012326 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.