Lus10012335 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G48170 138 / 3e-42 SNE, SLY2 SNEEZY, SLEEPY2, F-box family protein (.1)
AT4G24210 66 / 2e-14 SLY1 SLEEPY1, F-box family protein (.1)
AT5G44220 46 / 2e-06 F-box family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006381 256 / 9e-89 AT5G48170 140 / 5e-43 SNEEZY, SLEEPY2, F-box family protein (.1)
Lus10001172 160 / 6e-51 AT5G48170 164 / 2e-52 SNEEZY, SLEEPY2, F-box family protein (.1)
Lus10001745 117 / 1e-33 AT5G48170 114 / 1e-32 SNEEZY, SLEEPY2, F-box family protein (.1)
Lus10042637 61 / 5e-12 AT4G24210 186 / 6e-61 SLEEPY1, F-box family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G165700 150 / 4e-47 AT5G48170 144 / 9e-45 SNEEZY, SLEEPY2, F-box family protein (.1)
Potri.002G122300 66 / 6e-14 AT4G24210 185 / 2e-60 SLEEPY1, F-box family protein (.1)
Potri.014G022100 64 / 4e-13 AT4G24210 182 / 1e-59 SLEEPY1, F-box family protein (.1)
Potri.002G054500 47 / 2e-06 AT2G27310 122 / 2e-31 F-box family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0271 F-box PF00646 F-box F-box domain
Representative CDS sequence
>Lus10012335 pacid=23176747 polypeptide=Lus10012335 locus=Lus10012335.g ID=Lus10012335.BGIv1.0 annot-version=v1.0
ATGCCGACAGCTAGGCGGCAGCGGCGGTGGAGACAGGAAAACCAAGATACCTATGGTGTCATCAGCAACATCAACGACCACGTGGACATCCTAACCGAGG
TGCTGAAGCGGCTCGACTGGCGGTCTCTGTCCTCGGCCGCCTGCGTCTGCCGCCTGTGGAGCAGCATTGTCCGCAACGACGACGCGCTCTGGGAAGAGCT
CTGCTTCCGACACGTGTCTCCCCGGCCGTCGCCCTGGGTGCTGAGGCCCGTGGTGGGTGCTCTGGGAGGATACAAGCAGCTTTACATGGTCTACATACGG
CCCGTAGTGTTCAGGGTTGGATCGGTGGAGCGGCGGGTTTGGACCGCCGACGAGGTCCAGCTCTACTTGTCTTTGTTCTGCGTTGATTACTACGAGAGGC
TCGCCGGCGGCGGCGTAATTGGTGGGACCGAGTCGTCGTCTTCGTCCCTCGCGTTCCTGCTGTCCAGTCCTGTCAACGTTTGA
AA sequence
>Lus10012335 pacid=23176747 polypeptide=Lus10012335 locus=Lus10012335.g ID=Lus10012335.BGIv1.0 annot-version=v1.0
MPTARRQRRWRQENQDTYGVISNINDHVDILTEVLKRLDWRSLSSAACVCRLWSSIVRNDDALWEELCFRHVSPRPSPWVLRPVVGALGGYKQLYMVYIR
PVVFRVGSVERRVWTADEVQLYLSLFCVDYYERLAGGGVIGGTESSSSSLAFLLSSPVNV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G48170 SNE, SLY2 SNEEZY, SLEEPY2, F-box family ... Lus10012335 0 1
AT1G10710 PHS1 poor homologous synapsis 1 (.1... Lus10004624 7.3 0.8274
AT4G32000 Protein kinase superfamily pro... Lus10002328 9.8 0.9024
AT2G38720 MAP65-5 microtubule-associated protein... Lus10026114 11.0 0.8874
AT4G35240 Protein of unknown function (D... Lus10025077 17.3 0.8833
AT2G38720 MAP65-5 microtubule-associated protein... Lus10008705 20.6 0.8835
AT2G45260 Plant protein of unknown funct... Lus10008587 25.9 0.8815
AT5G51560 Leucine-rich repeat protein ki... Lus10031703 28.1 0.8814
AT2G28490 RmlC-like cupins superfamily p... Lus10011364 31.7 0.8688
AT5G61120 unknown protein Lus10035396 32.8 0.8649
AT2G35640 Trihelix Homeodomain-like superfamily p... Lus10018283 34.7 0.8740

Lus10012335 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.