Lus10012337 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07740 63 / 1e-12 HXA2, HXA02, HAC10, ATADA2A, ADA2A homolog of yeast ADA2 2A (.1.2.3.4)
AT4G16420 50 / 6e-08 PRZ1, ADA2B PROPORZ1, homolog of yeast ADA2 2B (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006383 191 / 5e-59 AT3G07740 581 / 0.0 homolog of yeast ADA2 2A (.1.2.3.4)
Lus10017553 49 / 1e-07 AT3G07740 625 / 0.0 homolog of yeast ADA2 2A (.1.2.3.4)
Lus10000540 39 / 0.0005 AT3G07740 499 / 2e-174 homolog of yeast ADA2 2A (.1.2.3.4)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G166300 81 / 9e-19 AT3G07740 582 / 0.0 homolog of yeast ADA2 2A (.1.2.3.4)
Potri.016G007600 46 / 1e-06 AT4G16420 602 / 0.0 PROPORZ1, homolog of yeast ADA2 2B (.1.2.3)
Potri.006G017300 44 / 1e-05 AT4G16420 640 / 0.0 PROPORZ1, homolog of yeast ADA2 2B (.1.2.3)
PFAM info
Representative CDS sequence
>Lus10012337 pacid=23176806 polypeptide=Lus10012337 locus=Lus10012337.g ID=Lus10012337.BGIv1.0 annot-version=v1.0
ATGAAGGAAGTCGAAGAGAGAGCGAAGGGAACCACACAAGGCGCTCCAAGTGGGAAAGGGCTGCTAAAGTCAAGCGATCAACTCAAGGCAGAAGTTGATG
GCAACAGTAGCAGCCCTCAAGGAGGAGCCGGTAAGAGTCCAACTGGCTCTCAACAAGTCATCCCAGATGTAGTGAACAAATGGGATATCACTGGGTTCCC
AGGAGCCAATTTGCTGTCTGAACCTGAGAAGCAACTGTGTGACCAAATGAGAATACTGCCAACACACTATCTGAAAATGCTTCAGATAATATCAACAGAG
GTGCGGAATCGGGAGTGTCTTTTAAGAAGAAAGCTGACGCGCACAGCTTATTCAAGGTGGAACCTAGCAAGATGA
AA sequence
>Lus10012337 pacid=23176806 polypeptide=Lus10012337 locus=Lus10012337.g ID=Lus10012337.BGIv1.0 annot-version=v1.0
MKEVEERAKGTTQGAPSGKGLLKSSDQLKAEVDGNSSSPQGGAGKSPTGSQQVIPDVVNKWDITGFPGANLLSEPEKQLCDQMRILPTHYLKMLQIISTE
VRNRECLLRRKLTRTAYSRWNLAR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G07740 HXA2, HXA02, HA... homolog of yeast ADA2 2A (.1.2... Lus10012337 0 1
AT4G01830 ABCB5, PGP5 ATP-binding cassette B5, P-gly... Lus10004529 2.6 1.0000
Lus10011759 3.5 1.0000
AT2G20420 ATP citrate lyase (ACL) family... Lus10024923 4.6 1.0000
AT4G00750 S-adenosyl-L-methionine-depend... Lus10027433 5.3 1.0000
Lus10013545 5.9 1.0000
AT4G24975 Plant self-incompatibility pro... Lus10032383 6.5 1.0000
Lus10017303 7.0 1.0000
AT3G50440 ATMES10 ARABIDOPSIS THALIANA METHYL ES... Lus10038486 8.0 1.0000
AT2G20370 AtMUR3, MUR3, K... MURUS 3, KATAMARI 1, Exostosin... Lus10040003 11.6 1.0000
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10010756 12.0 1.0000

Lus10012337 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.