Lus10012339 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G35790 179 / 6e-55 G6PD1 glucose-6-phosphate dehydrogenase 1 (.1)
AT1G24280 175 / 2e-53 G6PD3 glucose-6-phosphate dehydrogenase 3 (.1)
AT5G13110 173 / 1e-52 G6PD2 glucose-6-phosphate dehydrogenase 2 (.1)
AT1G09420 112 / 2e-30 G6PD4 glucose-6-phosphate dehydrogenase 4 (.1.2)
AT3G27300 79 / 1e-18 G6PD5 glucose-6-phosphate dehydrogenase 5 (.1.2.3)
AT5G40760 72 / 3e-16 G6PD6 glucose-6-phosphate dehydrogenase 6 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006386 197 / 1e-61 AT5G35790 904 / 0.0 glucose-6-phosphate dehydrogenase 1 (.1)
Lus10003134 172 / 3e-52 AT5G13110 973 / 0.0 glucose-6-phosphate dehydrogenase 2 (.1)
Lus10011340 172 / 4e-52 AT5G13110 967 / 0.0 glucose-6-phosphate dehydrogenase 2 (.1)
Lus10032079 78 / 3e-18 AT5G40760 873 / 0.0 glucose-6-phosphate dehydrogenase 6 (.1)
Lus10014615 78 / 5e-18 AT5G40760 905 / 0.0 glucose-6-phosphate dehydrogenase 6 (.1)
Lus10014614 77 / 6e-18 AT5G40760 782 / 0.0 glucose-6-phosphate dehydrogenase 6 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G166800 185 / 3e-57 AT5G35790 931 / 0.0 glucose-6-phosphate dehydrogenase 1 (.1)
Potri.003G168000 174 / 4e-53 AT5G13110 950 / 0.0 glucose-6-phosphate dehydrogenase 2 (.1)
Potri.001G059900 168 / 1e-50 AT5G13110 956 / 0.0 glucose-6-phosphate dehydrogenase 2 (.1)
Potri.013G005200 117 / 3e-32 AT1G09420 815 / 0.0 glucose-6-phosphate dehydrogenase 4 (.1.2)
Potri.017G070200 82 / 1e-19 AT5G40760 902 / 0.0 glucose-6-phosphate dehydrogenase 6 (.1)
Potri.001G337400 81 / 3e-19 AT5G40760 910 / 0.0 glucose-6-phosphate dehydrogenase 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0139 GADPH_aa-bio_dh PF02781 G6PD_C Glucose-6-phosphate dehydrogenase, C-terminal domain
Representative CDS sequence
>Lus10012339 pacid=23176762 polypeptide=Lus10012339 locus=Lus10012339.g ID=Lus10012339.BGIv1.0 annot-version=v1.0
ATGAGACTTGACCGCAGTGACCTCAATCTGCTGTATAAGGCCAGGTATCCAAGAGAAATCCCAGATGCTTACGAGAGGCTGCTGCTGGACGCCATAGAAG
GAGAAAGGAGGTTGTTTATAAGGAGTGACGAGCTTGATGCTGCGTGGGCACTGTTTACGCCGTTGTTGAAGGAACTTGAGGAGAAGAAAATAGTGCCGGA
GCTGTATCCTTACGGTAGCAGAGGTCCAGTTGGTGCACATTATCTTGCTGCTAAACATAATGTTCGCTGGGGAGATCTCAGTGGCGATGACTCTTAA
AA sequence
>Lus10012339 pacid=23176762 polypeptide=Lus10012339 locus=Lus10012339.g ID=Lus10012339.BGIv1.0 annot-version=v1.0
MRLDRSDLNLLYKARYPREIPDAYERLLLDAIEGERRLFIRSDELDAAWALFTPLLKELEEKKIVPELYPYGSRGPVGAHYLAAKHNVRWGDLSGDDS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G35790 G6PD1 glucose-6-phosphate dehydrogen... Lus10012339 0 1
AT5G35790 G6PD1 glucose-6-phosphate dehydrogen... Lus10012340 1.0 0.9334
AT4G11880 MADS AGL14 AGAMOUS-like 14 (.1) Lus10006716 3.2 0.8794
AT5G17230 PSY PHYTOENE SYNTHASE (.1.2.3) Lus10029809 5.7 0.8863
AT5G17230 PSY PHYTOENE SYNTHASE (.1.2.3) Lus10020729 5.7 0.8921
AT5G51980 C3HZnF Transducin/WD40 repeat-like su... Lus10001652 5.8 0.8437
AT1G14690 MAP65-7 microtubule-associated protein... Lus10035098 6.9 0.8707
AT4G31560 HCF153 high chlorophyll fluorescence ... Lus10039571 7.3 0.8763
AT5G17170 ENH1 enhancer of sos3-1, rubredoxin... Lus10002349 7.7 0.8883
AT4G25440 C3HZnF ZFWD1 zinc finger WD40 repeat protei... Lus10021655 8.8 0.8535
AT1G68800 TCP TCP12, BRC2, TC... BRANCHED 2, TCP domain protein... Lus10042962 10.9 0.8718

Lus10012339 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.