Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G07720 61 / 4e-12 Galactose oxidase/kelch repeat superfamily protein (.1) AT5G48180 49 / 6e-08 NSP5 nitrile specifier protein 5 (.1) AT3G16400 37 / 0.001 ATNSP1, ATMLP-470 MYROSINASE-BINDING PROTEIN-LIKE PROTEIN-470, nitrile specifier protein 1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006392 [exp] 45 / 3e-07 AT3G07720 118 / 7e-34 Galactose oxidase/kelch repeat superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G168300 [exp] 71 / 7e-16 AT3G07720 484 / 1e-173 Galactose oxidase/kelch repeat superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012345 pacid=23176742 polypeptide=Lus10012345 locus=Lus10012345.g ID=Lus10012345.BGIv1.0 annot-version=v1.0 ATGGGGAAGTACATTGTCATCTATGGTGGGGAAGTTGATCCTAGTGACTTGGGGCATATGGGTGCAGGAAAATTTACAGGGGAAGCCTATGCGTTGGGGC GAGCGGCTGTGGGAGCGGCTGGACGATGGGGCGAGCTTCGAGAACCATCCTGGTCCTCGGGGATGGTGCACTTACGCCACGGGAGAGCTCGAGGGGGAGA AGGGTTTGCTGGTGTATGGTGGGAATTTCCTACCAATGATAGGCTTGGTGACTTGTTCTTCTTCACTCCTTCCTTGGAGGCAATTGGTAGCTAG
AA sequence Show only first row Show all	>Lus10012345 pacid=23176742 polypeptide=Lus10012345 locus=Lus10012345.g ID=Lus10012345.BGIv1.0 annot-version=v1.0 MGKYIVIYGGEVDPSDLGHMGAGKFTGEAYALGRAAVGAAGRWGELREPSWSSGMVHLRHGRARGGEGFAGVWWEFPTNDRLGDLFFFTPSLEAIGS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G07720			Galactose oxidase/kelch repeat...		Lus10012345 [exp]	0	1
AT1G18590		SOT17, ATSOT17,...	ARABIDOPSIS SULFOTRANSFERASE 5...		Lus10017878 [exp]	1.4	0.8991
AT5G16080		ATCXE17	carboxyesterase 17 (.1)		Lus10041632 [exp]	2.4	0.8622
					Lus10039878 [exp]	3.0	0.8579
					Lus10029856 [exp]	4.2	0.8430
AT2G39770		VTC1, SOZ1, GMP...	VITAMIN C DEFECTIVE 1, SENSITI...		Lus10010880 [exp]	5.5	0.8546
AT5G47810		PFK2	phosphofructokinase 2 (.1)		Lus10039992 [exp]	6.0	0.8271
AT3G24490	Trihelix		Alcohol dehydrogenase transcri...		Lus10019568 [exp]	8.2	0.8006
AT3G47520		pNAD-MDH, MDH	plastidic NAD-dependent malate...		Lus10000275 [exp]	8.5	0.8465
AT5G63380			AMP-dependent synthetase and l...		Lus10032755 [exp]	10.2	0.8063
AT1G11840		ATGLX1	glyoxalase I homolog (.1.2.3.4...		Lus10000007 [exp]	11.8	0.8038

Compare expression of checked genes

Lus10012345 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.