Lus10012356 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07870 126 / 6e-34 F-box and associated interaction domains-containing protein (.1)
AT3G16210 64 / 2e-11 F-box family protein (.1)
AT3G17530 61 / 2e-10 F-box and associated interaction domains-containing protein (.1)
AT1G62270 58 / 1e-09 F-box and associated interaction domains-containing protein (.1)
AT3G23880 57 / 2e-09 F-box and associated interaction domains-containing protein (.1)
AT3G17480 56 / 7e-09 F-box and associated interaction domains-containing protein (.1)
AT3G49450 56 / 8e-09 F-box and associated interaction domains-containing protein (.1)
AT3G17540 56 / 1e-08 F-box and associated interaction domains-containing protein (.1)
AT1G33530 55 / 2e-08 F-box family protein (.1)
AT4G12560 52 / 1e-07 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012358 358 / 2e-123 AT3G07870 181 / 3e-52 F-box and associated interaction domains-containing protein (.1)
Lus10036105 91 / 1e-20 AT3G07870 206 / 1e-61 F-box and associated interaction domains-containing protein (.1)
Lus10012355 88 / 6e-20 AT3G07870 393 / 2e-135 F-box and associated interaction domains-containing protein (.1)
Lus10038603 76 / 1e-15 AT3G06240 110 / 2e-26 F-box family protein (.1)
Lus10006403 74 / 2e-15 AT3G07870 362 / 2e-124 F-box and associated interaction domains-containing protein (.1)
Lus10038606 74 / 4e-15 AT3G07870 112 / 1e-27 F-box and associated interaction domains-containing protein (.1)
Lus10037892 71 / 1e-13 AT3G06240 107 / 7e-26 F-box family protein (.1)
Lus10016866 60 / 4e-10 AT1G32420 84 / 2e-17 F-box and associated interaction domains-containing protein (.1)
Lus10018106 60 / 4e-10 AT3G06240 95 / 3e-21 F-box family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G162600 148 / 6e-42 AT3G07870 467 / 9e-164 F-box and associated interaction domains-containing protein (.1)
Potri.002G223000 137 / 5e-38 AT3G07870 467 / 5e-164 F-box and associated interaction domains-containing protein (.1)
Potri.001G224200 101 / 7e-25 AT3G07870 105 / 4e-25 F-box and associated interaction domains-containing protein (.1)
Potri.013G053301 97 / 3e-23 AT3G07870 258 / 7e-83 F-box and associated interaction domains-containing protein (.1)
Potri.011G037200 91 / 4e-21 AT3G07870 134 / 6e-35 F-box and associated interaction domains-containing protein (.1)
Potri.011G037312 91 / 1e-20 AT3G07870 134 / 3e-35 F-box and associated interaction domains-containing protein (.1)
Potri.017G058000 87 / 2e-19 AT3G06240 138 / 5e-37 F-box family protein (.1)
Potri.001G318400 81 / 1e-17 AT3G06240 142 / 3e-38 F-box family protein (.1)
Potri.017G058900 79 / 1e-16 AT3G06240 132 / 2e-34 F-box family protein (.1)
Potri.011G121200 78 / 2e-16 AT4G12560 116 / 9e-29 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0271 F-box PF00646 F-box F-box domain
Representative CDS sequence
>Lus10012356 pacid=23176809 polypeptide=Lus10012356 locus=Lus10012356.g ID=Lus10012356.BGIv1.0 annot-version=v1.0
ATGGAGGAAGCAGTACTGAAGAATGCAGCAGAAACCATGCGCGACAAGATGATTGTCAGTACTCTGCCTCGAGAAATCTTGATAGATATAATTTCAAGGC
TGCCAGTGTCATCTCTGCTCCAAATCAAGCTCGTATGCAGAGCATGGCGCCACCTTCTTCAAGACCCTCACCTTCCTTCCCTCCATTTCTCCCGACTAAC
AGCGAATCCGTCTCATCGCGGTACATCTTTGATTCTGCAGTCCAGGAGTTCTGCCAACAATGAGATCTACTTTCTAGATTTATCCAGTACTCGTGATAAC
GCCGAACCGGAGCTGAAGAGGAAACTATCAGTTCCAACGATGATTCCCGGTTTTATTGTGTTGGGTTCGTGCAGGGGGATTATGTGCTTAGCGAATGCAT
CACATCGCGTGCCAATTTACATTTACAATCCCCTTCTCGCAGAGATGCAAGAGATTGCTAGGCACAAGTGCGGCCCAAGCTACATCCTCGGATTCGGCTT
TCACCCAGCGATGAAAGAGTACAAATTAGTGACGGTTGCATCGATCTTAGAGAGAGCCTTTTTTCGGTTCCGAATATTTCCCGGCTCGGTTATATCAGTC
TTGACCCTAGCGTCGACCAAGAATGCAACTAAGTCCAATGAGTCCACTAGCTGGAGAAGAATAGGCACGGTGCCATACCACTTCCTAAAGCAAACAAACC
AAGTTCCCGTCTTGGGCCGACTTCATTGGGCTGCTCGTCGGAGAGACAACAGATCCTGA
AA sequence
>Lus10012356 pacid=23176809 polypeptide=Lus10012356 locus=Lus10012356.g ID=Lus10012356.BGIv1.0 annot-version=v1.0
MEEAVLKNAAETMRDKMIVSTLPREILIDIISRLPVSSLLQIKLVCRAWRHLLQDPHLPSLHFSRLTANPSHRGTSLILQSRSSANNEIYFLDLSSTRDN
AEPELKRKLSVPTMIPGFIVLGSCRGIMCLANASHRVPIYIYNPLLAEMQEIARHKCGPSYILGFGFHPAMKEYKLVTVASILERAFFRFRIFPGSVISV
LTLASTKNATKSNESTSWRRIGTVPYHFLKQTNQVPVLGRLHWAARRRDNRS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G07870 F-box and associated interacti... Lus10012356 0 1
AT4G26220 S-adenosyl-L-methionine-depend... Lus10012913 3.0 0.7170
Lus10032915 4.0 0.7730
AT1G22380 ATUGT85A3 UDP-glucosyl transferase 85A3 ... Lus10013919 6.0 0.7726
AT2G22180 hydroxyproline-rich glycoprote... Lus10019667 6.0 0.7700
AT1G22400 ATUGT85A1, UGT8... ARABIDOPSIS THALIANA UDP-GLUCO... Lus10013920 9.8 0.7383
AT2G16730 BGAL13 beta-galactosidase 13, glycosy... Lus10014126 11.0 0.7383
AT5G45670 GDSL-like Lipase/Acylhydrolase... Lus10015241 12.0 0.7383
AT5G20260 Exostosin family protein (.1) Lus10039980 13.0 0.7383
AT2G15130 Plant basic secretory protein ... Lus10026583 15.5 0.7107
AT1G18010 Major facilitator superfamily ... Lus10009413 17.2 0.7126

Lus10012356 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.