Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G07870 77 / 2e-17 F-box and associated interaction domains-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012358 [exp] 209 / 2e-67 AT3G07870 181 / 3e-52 F-box and associated interaction domains-containing protein (.1) Lus10006403 [exp] 65 / 2e-13 AT3G07870 362 / 2e-124 F-box and associated interaction domains-containing protein (.1) Lus10012355 [exp] 64 / 6e-13 AT3G07870 393 / 2e-135 F-box and associated interaction domains-containing protein (.1) Lus10036105 [exp] 52 / 2e-08 AT3G07870 206 / 1e-61 F-box and associated interaction domains-containing protein (.1) Lus10039024 [exp] 42 / 5e-05 AT4G12560 333 / 3e-111 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10027322 [exp] 40 / 0.0002 AT4G12560 150 / 6e-44 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G223000 [exp] 81 / 5e-19 AT3G07870 467 / 5e-164 F-box and associated interaction domains-containing protein (.1) Potri.014G162600 [exp] 81 / 8e-19 AT3G07870 467 / 9e-164 F-box and associated interaction domains-containing protein (.1) Potri.013G053301 [exp] 72 / 6e-16 AT3G07870 258 / 7e-83 F-box and associated interaction domains-containing protein (.1) Potri.001G129200 [exp] 61 / 8e-12 AT3G07870 110 / 8e-27 F-box and associated interaction domains-containing protein (.1) Potri.011G037200 [exp] 47 / 8e-07 AT3G07870 134 / 6e-35 F-box and associated interaction domains-containing protein (.1) Potri.011G037312 [exp] 45 / 2e-06 AT3G07870 134 / 3e-35 F-box and associated interaction domains-containing protein (.1) Potri.001G224200 [exp] 43 / 1e-05 AT3G07870 105 / 4e-25 F-box and associated interaction domains-containing protein (.1) Potri.006G011400 [exp] 42 / 4e-05 AT4G12560 142 / 2e-38 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.001G396800 [exp] 42 / 4e-05 AT3G07870 99 / 2e-22 F-box and associated interaction domains-containing protein (.1) Potri.008G215800 [exp] 41 / 7e-05 AT3G07870 101 / 3e-23 F-box and associated interaction domains-containing protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012357 pacid=23176768 polypeptide=Lus10012357 locus=Lus10012357.g ID=Lus10012357.BGIv1.0 annot-version=v1.0 ATGGTTGTTGGGACATGTATCGGGATTGCAGAGTACAAAGTTGGCGGGGAGATGAAGATATGGGTAATGAAGGAGTACGGCGTGGAGTCGTCTTGGGTTA ATGAGATGACAATTGAGACGTCGTCGTTTGGTAATCCAAATGCAGTGAGGAGATCATCAGGCACATATTTGCACATGATATCGAATTTTAGGGTGTTGTG TGCGTTGAGTAATGGGGAGGTGTTATTGGAGTTCAAGAGAAGAGGTTTGATTCGTTATGATCCGAAAAATGGTATTTTCAAGAATGTTTTGATCGATAGG GGAGGAGGAGGATTTTTGGTTGATGGGTTCAACGCAATTGTTCATGAGGGTAGCTTTTGTGACATTGATTCATGTATCAACATGTAG
AA sequence Show only first row Show all	>Lus10012357 pacid=23176768 polypeptide=Lus10012357 locus=Lus10012357.g ID=Lus10012357.BGIv1.0 annot-version=v1.0 MVVGTCIGIAEYKVGGEMKIWVMKEYGVESSWVNEMTIETSSFGNPNAVRRSSGTYLHMISNFRVLCALSNGEVLLEFKRRGLIRYDPKNGIFKNVLIDR GGGGFLVDGFNAIVHEGSFCDIDSCINM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G07870			F-box and associated interacti...		Lus10012357 [exp]	0	1
AT3G29090		PME31, ATPME31	A. THALIANA PECTIN METHYLESTER...		Lus10024049 [exp]	3.2	0.8402
AT1G06330			Heavy metal transport/detoxifi...		Lus10020704 [exp]	9.4	0.8689
AT5G03310			SAUR-like auxin-responsive pro...		Lus10037990 [exp]	12.0	0.8069
AT2G35930		PUB23	plant U-box 23 (.1)		Lus10013352 [exp]	20.7	0.8188
AT5G20630		ATGER3, GLP3A, ...	GERMIN-LIKE PROTEIN 3, ARABIDO...		Lus10037663 [exp]	23.0	0.8277
AT5G18080		SAUR24	small auxin up RNA 24, SAUR-li...		Lus10039962 [exp]	27.1	0.7745
AT5G34940		ATGUS3	glucuronidase 3 (.1.2.3)		Lus10038109 [exp]	54.9	0.7861
AT3G18880			Nucleic acid-binding, OB-fold-...		Lus10017993 [exp]	56.4	0.7801
AT2G43590			Chitinase family protein (.1)		Lus10024368 [exp]	59.7	0.7802
					Lus10032744 [exp]	77.8	0.7222

Compare expression of checked genes

Lus10012357 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.