Lus10012368 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G17080 106 / 2e-28 Arabidopsis protein of unknown function (DUF241) (.1)
AT4G35210 105 / 3e-28 Arabidopsis protein of unknown function (DUF241) (.1)
AT4G35200 102 / 4e-27 Arabidopsis protein of unknown function (DUF241) (.1)
AT2G17070 102 / 1e-26 Arabidopsis protein of unknown function (DUF241) (.1)
AT2G17680 48 / 7e-07 Arabidopsis protein of unknown function (DUF241) (.1)
AT4G35680 43 / 4e-05 Arabidopsis protein of unknown function (DUF241) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023962 197 / 8e-64 AT2G17080 214 / 4e-69 Arabidopsis protein of unknown function (DUF241) (.1)
Lus10023952 192 / 1e-61 AT2G17080 220 / 1e-71 Arabidopsis protein of unknown function (DUF241) (.1)
Lus10023960 191 / 1e-61 AT2G17080 227 / 3e-74 Arabidopsis protein of unknown function (DUF241) (.1)
Lus10025122 189 / 1e-60 AT4G35210 214 / 3e-69 Arabidopsis protein of unknown function (DUF241) (.1)
Lus10023963 185 / 1e-60 AT2G17080 139 / 6e-42 Arabidopsis protein of unknown function (DUF241) (.1)
Lus10023965 188 / 2e-60 AT2G17080 222 / 2e-72 Arabidopsis protein of unknown function (DUF241) (.1)
Lus10025125 187 / 8e-60 AT2G17080 219 / 4e-71 Arabidopsis protein of unknown function (DUF241) (.1)
Lus10025119 187 / 8e-60 AT2G17080 206 / 6e-66 Arabidopsis protein of unknown function (DUF241) (.1)
Lus10014449 186 / 2e-59 AT2G17080 213 / 6e-69 Arabidopsis protein of unknown function (DUF241) (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G142700 108 / 7e-29 AT2G17080 204 / 9e-65 Arabidopsis protein of unknown function (DUF241) (.1)
Potri.004G182550 107 / 1e-28 AT2G17080 196 / 6e-62 Arabidopsis protein of unknown function (DUF241) (.1)
Potri.004G182700 99 / 3e-25 AT2G17080 200 / 2e-63 Arabidopsis protein of unknown function (DUF241) (.1)
Potri.004G182400 96 / 3e-24 AT2G17070 193 / 2e-60 Arabidopsis protein of unknown function (DUF241) (.1)
Potri.004G182250 95 / 7e-24 AT2G17080 191 / 1e-59 Arabidopsis protein of unknown function (DUF241) (.1)
Potri.009G142600 95 / 7e-24 AT2G17080 202 / 6e-64 Arabidopsis protein of unknown function (DUF241) (.1)
Potri.009G142400 95 / 8e-24 AT2G17080 202 / 4e-64 Arabidopsis protein of unknown function (DUF241) (.1)
Potri.009G142500 93 / 5e-23 AT2G17070 175 / 2e-53 Arabidopsis protein of unknown function (DUF241) (.1)
Potri.002G012466 83 / 2e-19 AT2G17080 158 / 3e-47 Arabidopsis protein of unknown function (DUF241) (.1)
Potri.005G248975 80 / 3e-18 AT2G17080 164 / 2e-49 Arabidopsis protein of unknown function (DUF241) (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0133 AT14A-like PF03087 DUF241 Arabidopsis protein of unknown function
Representative CDS sequence
>Lus10012368 pacid=23176770 polypeptide=Lus10012368 locus=Lus10012368.g ID=Lus10012368.BGIv1.0 annot-version=v1.0
ATGGCAGCCACCACCTTCCACTTTCGATCCAACAGTTTCCCATCAAGGTCTCACCCTCTAGTTTCGGAGTTCGACGATCAACTTTGCAGGTTGACACAAT
CTCAAGCTGCCTCCACATCATCATCATCCATAAGCAACAGGCTTAATGGCCTTCAAGATGTTTATGACTGTGTTGACAAGTTAATTCAACTTCCATCAAC
TCGACAAGCCATGATCCATGACCAGAATGAGCTATTAGATGGATCTCTGAGACTGTTGGATCTGTGCAACACAGCCAGGGATGCCTTGTCCCAAATGAAA
GAGTCGGTTTCTGAACATCAATCCGTCATTCGCAGAAGGCAAGGAGACTTGGTAGCAGAAACCAAGAGATATCTTAACTCAAGGAAGGCTGTGAAGAAAA
AGGCCTTGAAGGCTATTGAAACGAAGAAATCTGAGACGGTTACCATGTCGGAAGAATCTGAGTCCATTGTTGTGGAAGGTTTGGGAAGCTTGTTGTCTTT
TCATCCATTCGTTATCCATATCGTAAAATTACAGTGA
AA sequence
>Lus10012368 pacid=23176770 polypeptide=Lus10012368 locus=Lus10012368.g ID=Lus10012368.BGIv1.0 annot-version=v1.0
MAATTFHFRSNSFPSRSHPLVSEFDDQLCRLTQSQAASTSSSSISNRLNGLQDVYDCVDKLIQLPSTRQAMIHDQNELLDGSLRLLDLCNTARDALSQMK
ESVSEHQSVIRRRQGDLVAETKRYLNSRKAVKKKALKAIETKKSETVTMSEESESIVVEGLGSLLSFHPFVIHIVKLQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G17080 Arabidopsis protein of unknown... Lus10012368 0 1
AT2G46330 ATAGP16, AGP16 arabinogalactan protein 16 (.1... Lus10024263 2.4 0.9368
AT1G28220 ATPUP3 purine permease 3 (.1) Lus10036465 2.8 0.8936
AT5G58380 PKS2, CIPK10, S... SNF1-RELATED PROTEIN KINASE 3.... Lus10014163 2.8 0.9362
AT5G60920 COB COBRA-like extracellular glyco... Lus10017861 4.5 0.8923
AT1G70670 AtCLO4 Arabidopsis thaliana caleosin ... Lus10041446 4.6 0.9075
AT5G39670 Calcium-binding EF-hand family... Lus10042369 8.8 0.8913
AT3G16500 AUX_IAA IAA26, PAP1 indole-3-acetic acid inducible... Lus10006842 11.0 0.8386
AT1G53400 Ubiquitin domain-containing pr... Lus10029264 12.0 0.8566
AT5G17680 disease resistance protein (TI... Lus10010221 12.1 0.8908
AT4G11170 Disease resistance protein (TI... Lus10010222 12.5 0.8733

Lus10012368 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.