Gene [FLAX] | FIBexDB

Lus10012369 [FLAX]

External link

Symbol

Arabidopsis homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	TF class	Alias	TAIR10 short description
AT1G70530	38 / 0.0009		CRK3	cysteine-rich RLK (RECEPTOR-like protein kinase) 3 (.1)

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10028019 [exp]	207 / 5e-70	AT1G70530	44 / 8e-06	cysteine-rich RLK (RECEPTOR-like protein kinase) 3 (.1)
Lus10015472 [exp]	144 / 3e-45	AT5G48540	42 / 4e-05	receptor-like protein kinase-related family protein (.1)
Lus10028018 [exp]	121 / 4e-36	ND	39 / 5e-04
Lus10003724 [exp]	103 / 4e-29	AT1G70530	45 / 7e-06	cysteine-rich RLK (RECEPTOR-like protein kinase) 3 (.1)
Lus10028017 [exp]	71 / 3e-15	AT1G03250	316 / 1e-106	unknown protein
Lus10020927 [exp]	64 / 1e-13	AT1G19090	45 / 7e-06	CYSTEINE-RICH RLK \(RECEPTOR-LIKE PROTEIN KINASE\) 1, receptor-like serine/threonine kinase 2 (.1)
Lus10033450 [exp]	61 / 1e-12	AT1G19090	45 / 7e-06	CYSTEINE-RICH RLK \(RECEPTOR-LIKE PROTEIN KINASE\) 1, receptor-like serine/threonine kinase 2 (.1)
Lus10011894 [exp]	60 / 5e-12	AT3G60720	38 / 9e-04	plasmodesmata-located protein 8 (.1)
Lus10033389 [exp]	59 / 9e-12	AT1G19090	44 / 2e-05	CYSTEINE-RICH RLK \(RECEPTOR-LIKE PROTEIN KINASE\) 1, receptor-like serine/threonine kinase 2 (.1)

Poplar homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Potri.005G208400 [exp]	45 / 8e-07	AT5G48540	52 / 1e-08	receptor-like protein kinase-related family protein (.1)
Potri.004G024900 [exp]	44 / 1e-05	AT4G23180	506 / 1e-171	cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G025900 [exp]	40 / 0.0003	AT4G23130	573 / 0.0	RECEPTOR-LIKE PROTEIN KINASE 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.2)
Potri.004G024404 [exp]	40 / 0.0003	AT4G23180	671 / 0.0	cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.011G028100 [exp]	39 / 0.0006	AT4G05200	519 / 8e-177	cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)

PFAM info

Clan ID	Clan name	Pfam ID	Pfam name	Pfam description
		PF01657 [flax] [poplar]	Stress-antifung	Salt stress response/antifungal

Representative CDS sequence

Show only first row Show all

>Lus10012369 pacid=23176822 polypeptide=Lus10012369 locus=Lus10012369.g ID=Lus10012369.BGIv1.0 annot-version=v1.0

ATGGGAGCAGTTGGTATACTAGTGGTGGCAATGTCTGGAGTTCTGATCATCATCGGACTTCATCGTGTCGCAAGCGTGGAAGTGACAAGTTGGGAATGCA

ACGCCTCCGAGTTTCCATCACACGACTCAAAGAGATCCCTCGTCCGAGTCCTTCTACAAGAGCTGGTGGAGAGCAAGTTACCTTACTGGGAAGACCGCCT

CTTGGGGACATCGATTCCTACGACGAACCCTTTGATTTACGCCTACGCCAACTGCACGGGTCCTCCTGATCCTTTTTCAGGTGAAGATAAATGCATTCCA

TGTCTGAGGTTGGCGAAACAAAGCCTACTTCGTAATTGTCCCCATCGAGTCGGGGCGAAAGTGTACTTGGACGTTTGTTATATGAGGTATGAAGATTACT

TCTTCTAA

AA sequence

Show only first row Show all

>Lus10012369 pacid=23176822 polypeptide=Lus10012369 locus=Lus10012369.g ID=Lus10012369.BGIv1.0 annot-version=v1.0

MGAVGILVVAMSGVLIIIGLHRVASVEVTSWECNASEFPSHDSKRSLVRVLLQELVESKLPYWEDRLLGTSIPTTNPLIYAYANCTGPPDPFSGEDKCIP

CLRLAKQSLLRNCPHRVGAKVYLDVCYMRYEDYFF

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G11470		CRK31	cysteine-rich RLK (RECEPTOR-li...		Lus10012369 [exp]	0	1

Lus10012369 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.