Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59310 58 / 3e-12 LTP4 lipid transfer protein 4 (.1) AT5G59320 54 / 1e-10 LTP3 lipid transfer protein 3 (.1) AT2G38530 51 / 2e-09 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT2G38540 51 / 2e-09 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT3G51600 44 / 2e-06 LTP5 lipid transfer protein 5 (.1) AT3G51590 42 / 5e-06 LTP12 lipid transfer protein 12 (.1) AT2G18370 39 / 6e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G08770 38 / 0.0001 LTP6 lipid transfer protein 6 (.1.2) AT4G33355 37 / 0.0005 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028055 [exp] 127 / 3e-39 AT5G59310 66 / 9e-15 lipid transfer protein 4 (.1) Lus10028002 [exp] 121 / 7e-37 AT5G59310 64 / 3e-14 lipid transfer protein 4 (.1) Lus10028003 [exp] 121 / 7e-37 AT5G59310 64 / 3e-14 lipid transfer protein 4 (.1) Lus10012383 [exp] 117 / 3e-35 AT5G59310 64 / 4e-14 lipid transfer protein 4 (.1) Lus10025148 [exp] 60 / 2e-12 AT5G01870 105 / 6e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10025230 [exp] 59 / 3e-12 AT3G08770 105 / 4e-30 lipid transfer protein 6 (.1.2) Lus10007280 [exp] 57 / 9e-12 AT5G59310 90 / 2e-24 lipid transfer protein 4 (.1) Lus10029226 [exp] 56 / 4e-11 AT5G59310 94 / 3e-26 lipid transfer protein 4 (.1) Lus10015278 [exp] 51 / 2e-09 AT5G59310 110 / 1e-32 lipid transfer protein 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G021900 [exp] 69 / 3e-16 AT3G08770 60 / 8e-13 lipid transfer protein 6 (.1.2) Potri.016G135700 [exp] 59 / 2e-12 AT5G59310 92 / 3e-25 lipid transfer protein 4 (.1) Potri.016G135800 [exp] 55 / 7e-11 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G136000 [exp] 55 / 9e-11 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.004G086600 [exp] 50 / 6e-09 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.004G086500 [exp] 50 / 7e-09 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G135500 [exp] 49 / 1e-08 AT5G59320 94 / 8e-26 lipid transfer protein 3 (.1) Potri.001G232900 [exp] 46 / 2e-07 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232700 [exp] 45 / 3e-07 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G025200 [exp] 44 / 1e-06 AT2G18370 86 / 6e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10012384 pacid=23176746 polypeptide=Lus10012384 locus=Lus10012384.g ID=Lus10012384.BGIv1.0 annot-version=v1.0 ATGGGTTCGACAACGAGTGTGGTTGCACAACAACCCTTAACATGCCCAGGTGCATTGTTGCAATTGCTACCTTGCTTGACGTACCTCACAAAACAAACAC CGTCTCCATCTCCTCAATGCTGCTCAAGTGTGAAACATTTGAACGATGAGGCCAACACCACTCCCATTCGCCAACAAATCTGCACCTGCTTCAAATCTGC GGCCATTGCCTATCACGTGGATCCAACCGTAGCCAAGGGTCTTCCGGATTCATGCCATGTTAATGTTCCTGTCCCCATCGATCCCAGTATTGATTGTAGC AAGTAA
AA sequence Show only first row Show all	>Lus10012384 pacid=23176746 polypeptide=Lus10012384 locus=Lus10012384.g ID=Lus10012384.BGIv1.0 annot-version=v1.0 MGSTTSVVAQQPLTCPGALLQLLPCLTYLTKQTPSPSPQCCSSVKHLNDEANTTPIRQQICTCFKSAAIAYHVDPTVAKGLPDSCHVNVPVPIDPSIDCS K

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59310		LTP4	lipid transfer protein 4 (.1)		Lus10012384 [exp]	0	1

Compare expression of checked genes

Lus10012384 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.