Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012394 pacid=23147286 polypeptide=Lus10012394 locus=Lus10012394.g ID=Lus10012394.BGIv1.0 annot-version=v1.0 ATGGCTAGCGAGGAACTTAACGATCCAGGCAGCTCCATTATGGTTTCTTCACTTCGAAAGGAGTTGCGTCGAGGACTTCCAGACGTGCCCATGGTTCTTA ACGCATCTTTCAAGATTCTCGACGAGTATAGGAAGCTTCCCATGTCATTTCTTGCTGATTTCAAGCCAAGTTCATGA
AA sequence Show only first row Show all	>Lus10012394 pacid=23147286 polypeptide=Lus10012394 locus=Lus10012394.g ID=Lus10012394.BGIv1.0 annot-version=v1.0 MASEELNDPGSSIMVSSLRKELRRGLPDVPMVLNASFKILDEYRKLPMSFLADFKPSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10012394 [exp]	0	1
AT1G75660		AtXRN3, XRN3	5'-3' exoribonuclease 3 (.1)		Lus10005213 [exp]	3.2	0.9843
AT1G21880		LYM1	lysm domain GPI-anchored prote...		Lus10006200 [exp]	4.7	0.9772
					Lus10008514 [exp]	5.0	0.8326
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10027028 [exp]	5.7	0.9772
AT1G02205		CER1	ECERIFERUM 1, Fatty acid hydro...		Lus10011472 [exp]	6.0	0.9530
AT3G16180			Major facilitator superfamily ...		Lus10009506 [exp]	6.6	0.9772
					Lus10033149 [exp]	7.4	0.9772
AT1G70690		HWI1, PDLP5	PLASMODESMATA-LOCATED PROTEIN ...		Lus10019334 [exp]	8.1	0.9772
AT1G29430			SAUR-like auxin-responsive pro...		Lus10020441 [exp]	8.8	0.9772
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10023215 [exp]	9.4	0.9772

Compare expression of checked genes

Lus10012394 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.