Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35150 49 / 6e-08 O-methyltransferase family protein (.1) AT4G35160 49 / 7e-08 O-methyltransferase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024678 [exp] 181 / 1e-58 AT4G35160 64 / 2e-11 O-methyltransferase family protein (.1) Lus10032304 [exp] 173 / 1e-54 AT4G35160 170 / 2e-49 O-methyltransferase family protein (.1) Lus10038331 [exp] 121 / 1e-33 AT4G35160 197 / 8e-58 O-methyltransferase family protein (.1) Lus10007035 [exp] 115 / 2e-32 AT4G35160 137 / 7e-38 O-methyltransferase family protein (.1) Lus10006692 [exp] 108 / 9e-30 AT4G35160 152 / 2e-42 O-methyltransferase family protein (.1) Lus10006691 [exp] 102 / 3e-27 AT4G35150 150 / 1e-41 O-methyltransferase family protein (.1) Lus10018629 [exp] 92 / 1e-23 AT4G35160 214 / 3e-66 O-methyltransferase family protein (.1) Lus10017691 [exp] 90 / 1e-22 AT4G35160 194 / 2e-58 O-methyltransferase family protein (.1) Lus10018628 [exp] 89 / 2e-22 AT4G35160 192 / 7e-58 O-methyltransferase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G122000 [exp] 97 / 3e-25 AT4G35160 174 / 6e-51 O-methyltransferase family protein (.1) Potri.013G121900 [exp] 96 / 5e-25 AT4G35160 184 / 5e-55 O-methyltransferase family protein (.1) Potri.013G121300 [exp] 96 / 5e-25 AT4G35160 201 / 4e-61 O-methyltransferase family protein (.1) Potri.013G122400 [exp] 95 / 1e-24 AT4G35160 188 / 2e-56 O-methyltransferase family protein (.1) Potri.013G120800 [exp] 94 / 3e-24 AT4G35160 205 / 7e-63 O-methyltransferase family protein (.1) Potri.019G093100 [exp] 92 / 1e-23 AT4G35160 225 / 1e-70 O-methyltransferase family protein (.1) Potri.013G121400 [exp] 92 / 2e-23 AT4G35160 202 / 8e-62 O-methyltransferase family protein (.1) Potri.013G120900 [exp] 87 / 5e-23 AT4G35160 75 / 3e-16 O-methyltransferase family protein (.1) Potri.019G093000 [exp] 89 / 3e-22 AT4G35160 230 / 1e-72 O-methyltransferase family protein (.1) Potri.011G059600 [exp] 86 / 2e-21 AT4G35160 196 / 3e-59 O-methyltransferase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [flax] [poplar] HTH PF08100 [flax] [poplar] Dimerisation Dimerisation domain
Representative CDS sequence Show only first row Show all	>Lus10012408 pacid=23147298 polypeptide=Lus10012408 locus=Lus10012408.g ID=Lus10012408.BGIv1.0 annot-version=v1.0 ATGGACGGAGAGAGAGCAATTGAGCTAATGGAAGCAGAAACTCAAGTCTGGAATCACGGCACAGGATACATCAAGTCGATGACTGTCCAATGTGCAATCG AGCTTGGAATTCCGGACGTTATCCACAGCCACGGAAGTCCGATGGCACTGCCTGACCTGGTCAACCGGCTCGGAATCCCTAACGAAAAAGCTCCTTTCCT CGGCCGCCTCATGCGTATGCTCGTCCACTTGGGCTACTTCAAAGAAGAAGAAGGTACTCGTAATAATGTTTACAAACCGAAAACAAAAAATAATAATTAA
AA sequence Show only first row Show all	>Lus10012408 pacid=23147298 polypeptide=Lus10012408 locus=Lus10012408.g ID=Lus10012408.BGIv1.0 annot-version=v1.0 MDGERAIELMEAETQVWNHGTGYIKSMTVQCAIELGIPDVIHSHGSPMALPDLVNRLGIPNEKAPFLGRLMRMLVHLGYFKEEEGTRNNVYKPKTKNNN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G35150			O-methyltransferase family pro...		Lus10012408 [exp]	0	1
					Lus10024679 [exp]	1.0	0.8622
					Lus10023538 [exp]	1.4	0.8475
AT4G39830			Cupredoxin superfamily protein...		Lus10037103 [exp]	3.3	0.8129
AT1G30840		ATPUP4	purine permease 4 (.1.2)		Lus10002868 [exp]	6.6	0.7782
AT1G64160			Disease resistance-responsive ...		Lus10028749 [exp]	6.8	0.6889
AT1G65450			HXXXD-type acyl-transferase fa...		Lus10029920 [exp]	9.2	0.8405
AT5G11730			Core-2/I-branching beta-1,6-N-...		Lus10034348 [exp]	10.6	0.8405
					Lus10011637 [exp]	11.6	0.8394
					Lus10017181 [exp]	13.1	0.6926
AT5G37060		ATCHX24	cation/H+ exchanger 24, ARABID...		Lus10031852 [exp]	13.2	0.8277

Compare expression of checked genes

Lus10012408 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.