Lus10012426 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G75590 181 / 2e-59 SAUR-like auxin-responsive protein family (.1)
AT5G10990 177 / 4e-58 SAUR-like auxin-responsive protein family (.1)
AT1G19840 177 / 4e-58 SAUR-like auxin-responsive protein family (.1)
AT4G34750 134 / 4e-41 SAUR-like auxin-responsive protein family (.1.2)
AT5G20810 85 / 2e-21 SAUR-like auxin-responsive protein family (.1.2)
AT2G24400 85 / 2e-21 SAUR-like auxin-responsive protein family (.1)
AT4G34760 83 / 2e-21 SAUR-like auxin-responsive protein family (.1)
AT2G21220 82 / 6e-21 SAUR-like auxin-responsive protein family (.1)
AT4G38860 76 / 1e-18 SAUR-like auxin-responsive protein family (.1)
AT2G18010 76 / 1e-18 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024322 251 / 2e-87 AT1G75590 152 / 3e-48 SAUR-like auxin-responsive protein family (.1)
Lus10034507 217 / 1e-73 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1)
Lus10033161 203 / 4e-68 AT1G75590 187 / 4e-62 SAUR-like auxin-responsive protein family (.1)
Lus10042374 127 / 4e-38 AT5G10990 125 / 8e-38 SAUR-like auxin-responsive protein family (.1)
Lus10026297 124 / 1e-36 AT5G10990 125 / 2e-37 SAUR-like auxin-responsive protein family (.1)
Lus10012190 119 / 6e-35 AT4G34750 147 / 4e-46 SAUR-like auxin-responsive protein family (.1.2)
Lus10021130 89 / 1e-23 AT4G34750 97 / 8e-27 SAUR-like auxin-responsive protein family (.1.2)
Lus10017179 82 / 1e-20 AT4G34750 89 / 6e-24 SAUR-like auxin-responsive protein family (.1.2)
Lus10041921 77 / 8e-19 AT4G34760 144 / 7e-46 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G237000 213 / 5e-72 AT1G75590 200 / 4e-67 SAUR-like auxin-responsive protein family (.1)
Potri.002G024500 209 / 2e-70 AT1G75590 194 / 1e-64 SAUR-like auxin-responsive protein family (.1)
Potri.004G164300 174 / 6e-57 AT5G10990 170 / 3e-55 SAUR-like auxin-responsive protein family (.1)
Potri.009G125900 169 / 7e-55 AT5G10990 157 / 5e-50 SAUR-like auxin-responsive protein family (.1)
Potri.006G278100 84 / 3e-21 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1)
Potri.008G003900 82 / 1e-20 AT2G24400 110 / 1e-31 SAUR-like auxin-responsive protein family (.1)
Potri.004G164400 80 / 4e-20 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1)
Potri.009G126000 79 / 1e-19 AT4G34760 179 / 4e-60 SAUR-like auxin-responsive protein family (.1)
Potri.006G137200 80 / 4e-19 AT5G20810 201 / 1e-66 SAUR-like auxin-responsive protein family (.1.2)
Potri.010G253800 79 / 5e-19 AT2G24400 142 / 4e-43 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10012426 pacid=23160970 polypeptide=Lus10012426 locus=Lus10012426.g ID=Lus10012426.BGIv1.0 annot-version=v1.0
ATGTCGACGACCGGATTATCAAAGTGCGCCAAAATCCGACACATAGTTCGGCTGCGGCAAATGCTGCGGCGGTGGAGGAACAAGGCCCGTGTATCAGCCA
ACAAGATTCCTTCCGACGTCCCCTCCGGCCACATCGCCGTCTGCGTCGGAATCAGCTTCCGGAGATTCGTGGTCCGGACTACCTACCTGAACCACCCGGT
GTTCAGCAATCTCCTGAACCAAGCTGAAGAAGAGTTCGGATTCTCCAACCAAGGCCCACTCACAATACCCTGCGATGAGGCCGTTTTCGAGGAAGCAATC
CGGTACATTTCCAGATCCGAGTCCGGAAATCTCGAAGATCTCAAGAAGAGCTGCTGCCACAGATTTGGGATCCGGAGGAAGACTGATTTGTGGACCGAGT
CACGCCCCCTGCTCGCTGAGAAAACCATATGTCATATGATTGATTGGATTAACTAG
AA sequence
>Lus10012426 pacid=23160970 polypeptide=Lus10012426 locus=Lus10012426.g ID=Lus10012426.BGIv1.0 annot-version=v1.0
MSTTGLSKCAKIRHIVRLRQMLRRWRNKARVSANKIPSDVPSGHIAVCVGISFRRFVVRTTYLNHPVFSNLLNQAEEEFGFSNQGPLTIPCDEAVFEEAI
RYISRSESGNLEDLKKSCCHRFGIRRKTDLWTESRPLLAEKTICHMIDWIN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G75590 SAUR-like auxin-responsive pro... Lus10012426 0 1
AT1G75590 SAUR-like auxin-responsive pro... Lus10024322 1.0 0.9171
AT4G32890 GATA GATA9 GATA transcription factor 9 (.... Lus10025829 3.7 0.9146
AT3G27090 DCD (Development and Cell Deat... Lus10012533 5.9 0.8957
AT1G75780 TUB1 tubulin beta-1 chain (.1) Lus10021094 8.1 0.8956
AT2G26700 PID2 PINOID2, AGC (cAMP-dependent, ... Lus10013715 12.5 0.8964
AT4G27760 FEY3, FEY FOREVER YOUNG, NAD(P)-binding ... Lus10028534 15.9 0.8897
AT1G50370 AtFYPP1 flower- specific, phytochrome-... Lus10017361 16.3 0.8699
AT2G40620 bZIP AtbZIP18 Basic-leucine zipper (bZIP) tr... Lus10008605 17.7 0.8909
AT1G10850 Leucine-rich repeat protein ki... Lus10029075 18.3 0.8808
AT4G23820 Pectin lyase-like superfamily ... Lus10003890 19.4 0.8914

Lus10012426 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.