Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G61180 120 / 8e-34 RING/U-box superfamily protein (.1) AT4G11680 112 / 8e-31 Zinc finger, C3HC4 type (RING finger) family protein (.1) AT1G12760 107 / 6e-29 Zinc finger, C3HC4 type (RING finger) family protein (.1), Zinc finger, C3HC4 type (RING finger) family protein (.2) AT1G63170 105 / 4e-28 Zinc finger, C3HC4 type (RING finger) family protein (.1) AT1G68070 82 / 1e-19 Zinc finger, C3HC4 type (RING finger) family protein (.1) AT2G01735 79 / 1e-18 RIE1 RING-finger protein for embryogenesis (.1) AT4G26580 40 / 0.0002 RING/U-box superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036569 [exp] 166 / 2e-51 AT3G61180 387 / 1e-133 RING/U-box superfamily protein (.1) Lus10041359 [exp] 163 / 4e-50 AT3G61180 400 / 6e-139 RING/U-box superfamily protein (.1) Lus10006313 [exp] 105 / 3e-28 AT4G11680 456 / 8e-161 Zinc finger, C3HC4 type (RING finger) family protein (.1) Lus10034587 [exp] 84 / 4e-20 AT1G68070 489 / 6e-172 Zinc finger, C3HC4 type (RING finger) family protein (.1) Lus10021801 [exp] 83 / 9e-20 AT1G68070 478 / 1e-169 Zinc finger, C3HC4 type (RING finger) family protein (.1) Lus10029582 [exp] 49 / 1e-07 AT3G61180 315 / 3e-106 RING/U-box superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G123300 [exp] 108 / 4e-29 AT1G12760 400 / 7e-138 Zinc finger, C3HC4 type (RING finger) family protein (.1), Zinc finger, C3HC4 type (RING finger) family protein (.2) Potri.014G075000 [exp] 96 / 2e-24 AT3G61180 315 / 1e-105 RING/U-box superfamily protein (.1) Potri.002G155200 [exp] 93 / 1e-23 AT3G61180 366 / 3e-125 RING/U-box superfamily protein (.1) Potri.008G134900 [exp] 83 / 7e-20 AT1G68070 392 / 2e-136 Zinc finger, C3HC4 type (RING finger) family protein (.1) Potri.010G106300 [exp] 73 / 3e-16 AT1G68070 412 / 2e-144 Zinc finger, C3HC4 type (RING finger) family protein (.1) Potri.001G371200 [exp] 39 / 0.0002 AT5G55970 424 / 3e-149 RING/U-box superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012427 pacid=23160978 polypeptide=Lus10012427 locus=Lus10012427.g ID=Lus10012427.BGIv1.0 annot-version=v1.0 ATGCCTCTCCATGGGCTTCTGAGTGGAGCGAGCAGCCGTCGTATGATTCTCCGGGAGCCTTCTGTTACGGTCCGCGAGAACGCAGCTGAGCAGCTCGAGG AGCGGCAGACTGACTGGTCCTACTCCACTCCTGCAATCCTGCTGGATGTGTGGAACCTGGCGTTCTTCGGAATCACGGCTGTTGCTCTGGTGATAAGCAC GAATGAGAAGCCGGTGCCGTTGAGGCTGTGGATCGTGGGATACGGTCTTCGGTGTTTGTTTCACGTCGGATGCGTCGTTGGCGAGTACAGGCGGCGGCGG CGGCGGCTTCCCGGAAGTAAGGTTAGGGTTGGTGGATAG
AA sequence Show only first row Show all	>Lus10012427 pacid=23160978 polypeptide=Lus10012427 locus=Lus10012427.g ID=Lus10012427.BGIv1.0 annot-version=v1.0 MPLHGLLSGASSRRMILREPSVTVRENAAEQLEERQTDWSYSTPAILLDVWNLAFFGITAVALVISTNEKPVPLRLWIVGYGLRCLFHVGCVVGEYRRRR RRLPGSKVRVGG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G61180			RING/U-box superfamily protein...		Lus10012427 [exp]	0	1
AT1G21240		WAK3	wall associated kinase 3 (.1)		Lus10013387 [exp]	4.7	0.8869
					Lus10039781 [exp]	6.9	0.8830
AT5G38700			unknown protein		Lus10002433 [exp]	12.7	0.8867
					Lus10000510 [exp]	12.7	0.8645
AT5G58610			PHD finger transcription facto...		Lus10025387 [exp]	14.1	0.8247
AT2G38080		ATLMCO4, IRX12,...	LACCASE 4, IRREGULAR XYLEM 12,...		Lus10021133 [exp]	18.2	0.8765
AT1G07160			Protein phosphatase 2C family ...		Lus10026381 [exp]	21.7	0.8639
AT1G17420		ATLOX3, LOX3	Arabidopsis thaliana lipoxygen...		Lus10008113 [exp]	22.2	0.8669
AT3G03280			unknown protein		Lus10007960 [exp]	22.8	0.8692
AT5G18310			unknown protein		Lus10042520 [exp]	27.2	0.8217

Compare expression of checked genes

Lus10012427 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.