Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G75580 157 / 3e-51 SAUR-like auxin-responsive protein family (.1) AT4G34760 157 / 4e-51 SAUR-like auxin-responsive protein family (.1) AT2G21220 144 / 5e-46 SAUR-like auxin-responsive protein family (.1) AT2G16580 144 / 7e-46 SAUR-like auxin-responsive protein family (.1) AT1G19830 144 / 1e-45 SAUR-like auxin-responsive protein family (.1) AT4G38860 138 / 1e-43 SAUR-like auxin-responsive protein family (.1) AT4G36110 134 / 6e-42 SAUR-like auxin-responsive protein family (.1) AT2G18010 129 / 6e-40 SAUR-like auxin-responsive protein family (.1) AT5G66260 105 / 1e-30 SAUR-like auxin-responsive protein family (.1) AT4G34770 88 / 7e-24 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024326 [exp] 208 / 4e-71 AT1G75580 166 / 2e-54 SAUR-like auxin-responsive protein family (.1) Lus10033159 [exp] 160 / 3e-52 AT1G75580 160 / 1e-52 SAUR-like auxin-responsive protein family (.1) Lus10034511 [exp] 158 / 2e-51 AT1G75580 161 / 9e-53 SAUR-like auxin-responsive protein family (.1) Lus10007553 [exp] 150 / 3e-48 AT4G34760 168 / 9e-56 SAUR-like auxin-responsive protein family (.1) Lus10012189 [exp] 150 / 5e-48 AT4G34760 169 / 3e-56 SAUR-like auxin-responsive protein family (.1) Lus10028466 [exp] 123 / 2e-37 AT4G34760 151 / 5e-49 SAUR-like auxin-responsive protein family (.1) Lus10041921 [exp] 119 / 9e-36 AT4G34760 144 / 7e-46 SAUR-like auxin-responsive protein family (.1) Lus10026296 [exp] 118 / 1e-35 AT4G34760 133 / 4e-42 SAUR-like auxin-responsive protein family (.1) Lus10032173 [exp] 93 / 3e-25 AT4G38840 119 / 3e-36 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G164400 [exp] 166 / 8e-55 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1) Potri.009G126000 [exp] 164 / 9e-54 AT4G34760 179 / 4e-60 SAUR-like auxin-responsive protein family (.1) Potri.002G024300 [exp] 162 / 3e-53 AT1G75580 170 / 2e-56 SAUR-like auxin-responsive protein family (.1) Potri.005G237200 [exp] 156 / 1e-50 AT1G75580 164 / 5e-54 SAUR-like auxin-responsive protein family (.1) Potri.007G012800 [exp] 150 / 2e-48 AT4G34760 164 / 3e-54 SAUR-like auxin-responsive protein family (.1) Potri.009G126700 [exp] 91 / 5e-25 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 89 / 3e-24 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.004G165900 [exp] 88 / 1e-23 AT4G34770 99 / 9e-29 SAUR-like auxin-responsive protein family (.1) Potri.004G164700 [exp] 85 / 1e-22 AT5G18020 122 / 8e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G127300 [exp] 85 / 1e-22 AT2G21210 104 / 8e-31 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10012432 pacid=23160967 polypeptide=Lus10012432 locus=Lus10012432.g ID=Lus10012432.BGIv1.0 annot-version=v1.0 ATGGCCATAAGGAAAACAAAATCAAACAAGCTTCCACAACCAGCAGTCCTCAAACAGATCCTGAGGAGATGCTCCAGCTTAGGCAAGAGATCATCCGAAG GAGGATACCAAGAAGGCGGCTTCGGACGAGGAGGAGGAGGACTTCCACTGGATGTACCAAAGGGACACTTCGTGGTGTACATTGGGGAGAATAGGAGCAG GTACATTGTCCCCATCTCGTTCCTTAGCAGGCCGGAGTTCCAGAGCTTGCTTCATAAAGCTGAGGAGGAGTTTGGGTTCGACCACGACATGGGTTTAACC ATCCCTTGTGAAGAAGTCGTCTTCCAGTCTTTAACTTCCATGCTCTCTTCACCTACTACTTATAATTGA
AA sequence Show only first row Show all	>Lus10012432 pacid=23160967 polypeptide=Lus10012432 locus=Lus10012432.g ID=Lus10012432.BGIv1.0 annot-version=v1.0 MAIRKTKSNKLPQPAVLKQILRRCSSLGKRSSEGGYQEGGFGRGGGGLPLDVPKGHFVVYIGENRSRYIVPISFLSRPEFQSLLHKAEEEFGFDHDMGLT IPCEEVVFQSLTSMLSSPTTYN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G75580			SAUR-like auxin-responsive pro...		Lus10012432 [exp]	0	1
AT1G05490		CHR31	chromatin remodeling 31 (.1)		Lus10011033 [exp]	3.2	0.9138
AT2G33510		AtCFL1	unknown protein		Lus10001804 [exp]	7.3	0.8985
AT1G70170		MMP	matrix metalloproteinase (.1)		Lus10041293 [exp]	8.9	0.8786
AT4G37810			unknown protein		Lus10019254 [exp]	13.1	0.8852
AT5G52870		MAKR5	MEMBRANE-ASSOCIATED KINASE REG...		Lus10039306 [exp]	16.4	0.8668
AT5G14070		ROXY2	Thioredoxin superfamily protei...		Lus10011333 [exp]	26.7	0.8956
AT1G23220			Dynein light chain type 1 fami...		Lus10021793 [exp]	27.4	0.8812
AT2G27880		AGO5	ARGONAUTE 5, Argonaute family ...		Lus10014386 [exp]	30.9	0.8829
AT5G14070		ROXY2	Thioredoxin superfamily protei...		Lus10003141 [exp]	38.0	0.8825
AT1G75080	BZR	BZR1	BRASSINAZOLE-RESISTANT 1, Bras...		Lus10026036 [exp]	39.2	0.8745

Compare expression of checked genes

Lus10012432 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.