Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19660 84 / 1e-23 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033765 [exp] 115 / 6e-36 AT3G19660 82 / 1e-22 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G290200 [exp] 100 / 1e-29 AT3G19660 71 / 2e-18 unknown protein Potri.009G085800 [exp] 97 / 2e-28 AT3G19660 64 / 2e-15 unknown protein Potri.017G109900 [exp] 60 / 7e-14 AT3G19660 49 / 1e-09 unknown protein Potri.017G109800 [exp] 54 / 8e-12 AT3G19660 50 / 6e-10 unknown protein Potri.004G105800 [exp] 52 / 1e-10 AT3G19660 41 / 3e-06 unknown protein Potri.004G105900 [exp] 50 / 6e-10 AT3G19660 46 / 2e-08 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012438 pacid=23145778 polypeptide=Lus10012438 locus=Lus10012438.g ID=Lus10012438.BGIv1.0 annot-version=v1.0 ATGGCGATCCAGCTGGAGAGCCTTGTGGAGTCGATAAAGTCCAAGGTGAAAGGAGCGCTGAGGAAGTCGAAGAAGAAGCCTTACGTGAAGATGGACAAGA GCGCTAGCGTCAGAGTCGAGATTCGTAGCCGTAAGGCCAAGAAGCTCATAGACAAAACGCTCAAGGTCGCCGATCGCCCTGGCAAGCGCAGCCTCTCTTA A
AA sequence Show only first row Show all	>Lus10012438 pacid=23145778 polypeptide=Lus10012438 locus=Lus10012438.g ID=Lus10012438.BGIv1.0 annot-version=v1.0 MAIQLESLVESIKSKVKGALRKSKKKPYVKMDKSASVRVEIRSRKAKKLIDKTLKVADRPGKRSLS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G19660			unknown protein		Lus10012438 [exp]	0	1
AT3G13790		ATCWINV1, ATBFR...	ARABIDOPSIS THALIANA CELL WALL...		Lus10008392 [exp]	2.4	0.9463
AT3G52190		AtPHF1, PHF1	phosphate transporter traffic ...		Lus10037923 [exp]	3.5	0.9328
AT1G29760			Putative adipose-regulatory pr...		Lus10033273 [exp]	4.7	0.9291
AT5G10820			Major facilitator superfamily ...		Lus10026890 [exp]	5.2	0.9369
AT3G62150		ABCB21, PGP21	ATP-binding cassette B21, P-gl...		Lus10000052 [exp]	9.9	0.9451
AT4G15560		AtCLA1, DXS, DX...	1-DEOXY-D-XYLULOSE 5-PHOSPHATE...		Lus10019992 [exp]	15.0	0.9214
AT4G14410	bHLH	bHLH104	basic Helix-Loop-Helix 104, ba...		Lus10041148 [exp]	15.0	0.9226
AT4G30600			signal recognition particle re...		Lus10035066 [exp]	15.7	0.9365
AT3G57530		ATCPK32, CDPK32...	calcium-dependent protein kina...		Lus10026742 [exp]	20.8	0.9310
AT1G03590			Protein phosphatase 2C family ...		Lus10033708 [exp]	22.4	0.9228

Compare expression of checked genes

Lus10012438 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.