Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G08170 72 / 8e-17 Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1.2.3) AT4G33770 59 / 1e-11 Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020513 [exp] 118 / 3e-34 AT4G08170 331 / 2e-113 Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1.2.3) Lus10035662 [exp] 76 / 1e-17 AT4G08170 455 / 2e-161 Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1.2.3) Lus10032808 [exp] 66 / 5e-14 AT4G08170 500 / 5e-179 Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1.2.3) Lus10007689 [exp] 65 / 6e-14 AT4G08170 499 / 2e-178 Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1.2.3) Lus10037247 [exp] 64 / 7e-14 AT4G08170 345 / 3e-119 Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G084600 [exp] 72 / 1e-16 AT4G08170 379 / 1e-131 Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1.2.3) Potri.005G149800 [exp] 72 / 2e-16 AT4G08170 518 / 0.0 Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0179 [flax] [poplar] ATP-grasp PF05770 [flax] [poplar] Ins134_P3_kin Inositol 1,3,4-trisphosphate 5/6-kinase ATP-grasp domain
Representative CDS sequence Show only first row Show all	>Lus10012447 pacid=23145795 polypeptide=Lus10012447 locus=Lus10012447.g ID=Lus10012447.BGIv1.0 annot-version=v1.0 ATGGGAGAATCCATTAAAGTTGTCCGTCGCTTCTCTCTACCTAATGTCAGTAATTGTGAGCTAGAAAAAGTAGCTGGTGTGATGCGGTTCCCCCGAGTTT CATGTGCTGCAGCCTCTGCAGATGATGCTGATTTGGATCCTTCAGTTGCAGGTTATGGGAAAATGCCAGACTATGAGCACCTCTTCACAGATTTCCTACT TAGTGAAGCGCAGAGTAAACAGAAGAAGGGACAGGCTGCTTGA
AA sequence Show only first row Show all	>Lus10012447 pacid=23145795 polypeptide=Lus10012447 locus=Lus10012447.g ID=Lus10012447.BGIv1.0 annot-version=v1.0 MGESIKVVRRFSLPNVSNCELEKVAGVMRFPRVSCAAASADDADLDPSVAGYGKMPDYEHLFTDFLLSEAQSKQKKGQAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G08170			Inositol 1,3,4-trisphosphate 5...		Lus10012447 [exp]	0	1
AT4G02210			unknown protein		Lus10032996 [exp]	116.1	0.5035
AT1G26480		GF14IOTA, GRF12	general regulatory factor 12 (...		Lus10037090 [exp]	239.8	0.4913

Compare expression of checked genes

Lus10012447 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.