Lus10012466 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G70830 151 / 3e-47 MLP28 MLP-like protein 28 (.1.2.3.4.5)
AT1G70840 143 / 4e-44 MLP31 MLP-like protein 31 (.1)
AT1G70850 145 / 6e-44 MLP34 MLP-like protein 34 (.1.2.3)
AT1G70890 140 / 4e-43 MLP43 MLP-like protein 43 (.1)
AT5G28010 134 / 9e-41 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G70880 130 / 2e-39 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G23130 111 / 1e-31 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT5G28000 105 / 3e-29 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G35260 90 / 2e-23 MLP165 MLP-like protein 165 (.1)
AT1G70860 82 / 3e-21 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020498 297 / 4e-105 AT1G70830 160 / 7e-51 MLP-like protein 28 (.1.2.3.4.5)
Lus10012742 268 / 2e-93 AT1G70830 158 / 6e-50 MLP-like protein 28 (.1.2.3.4.5)
Lus10020497 187 / 1e-61 AT1G70840 148 / 4e-46 MLP-like protein 31 (.1)
Lus10002644 92 / 3e-25 AT1G70850 58 / 1e-11 MLP-like protein 34 (.1.2.3)
Lus10042490 92 / 4e-24 AT1G14930 107 / 3e-30 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10042489 82 / 2e-20 AT1G14960 104 / 5e-29 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10033397 75 / 2e-17 AT1G14950 121 / 1e-35 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10028887 74 / 7e-17 AT2G01520 129 / 1e-38 \(Zusammen-CA\)-enhanced 1, MLP-like protein 328 (.1)
Lus10008932 76 / 8e-17 AT4G14060 127 / 1e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G111000 187 / 9e-62 AT1G70830 175 / 8e-57 MLP-like protein 28 (.1.2.3.4.5)
Potri.017G051200 120 / 9e-36 AT1G70840 116 / 3e-34 MLP-like protein 31 (.1)
Potri.017G051100 118 / 2e-34 AT1G70840 115 / 3e-33 MLP-like protein 31 (.1)
Potri.008G131300 88 / 2e-22 AT1G14930 100 / 1e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.008G131200 85 / 1e-21 AT1G14930 122 / 4e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.008G131100 78 / 7e-19 AT1G70890 107 / 3e-30 MLP-like protein 43 (.1)
Potri.010G096000 64 / 1e-13 AT1G24020 188 / 3e-62 MLP-like protein 423 (.1.2)
Potri.013G131000 46 / 1e-06 AT1G24020 62 / 1e-12 MLP-like protein 423 (.1.2)
Potri.004G020000 44 / 6e-06 AT1G70880 69 / 3e-15 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.004G020100 40 / 0.0002 AT1G70880 58 / 5e-11 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF00407 Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence
>Lus10012466 pacid=23145763 polypeptide=Lus10012466 locus=Lus10012466.g ID=Lus10012466.BGIv1.0 annot-version=v1.0
ATGAGTTGCTGTAGTCTGGTACATGGGAAGCTGGAGGCATATGTTGGAGTAAGAGTAGCTGCTGATATTTTCCATGACATCTTCAGTGGAAGACCTCACC
ATATCTCCAACATGGCTCCCCAGAAGATCAAGGGCTGTGACGTCCATGAAGGTGAATGGGGCAAACCAGGCACTGTCATCTGCTGGGATTACTTCCACGA
TGGGGAAGCAAAGGTGGCGAAAGAGGTGATCGAGGAGATCGACGATGTGAATCTGTCGACGACCTTTAAGGTGATAGAAGGAGATCTGATGAAGGACTAC
AAGAACTTCAAGCTGGTTGTTAAGGCCACTCCGCAAAAGAAGACCGAGGGACAAGACTGGTGCTTGGTTCACTGGATCCTGGACTACGAAAAGCTGAAAG
AGGAAACCCCGGAGCCTTTCTCCCTGCTTGAGCTTGTGGTTCACACCAGCAAAGACATTGATGACCATCACACCAAGAAGAAATGA
AA sequence
>Lus10012466 pacid=23145763 polypeptide=Lus10012466 locus=Lus10012466.g ID=Lus10012466.BGIv1.0 annot-version=v1.0
MSCCSLVHGKLEAYVGVRVAADIFHDIFSGRPHHISNMAPQKIKGCDVHEGEWGKPGTVICWDYFHDGEAKVAKEVIEEIDDVNLSTTFKVIEGDLMKDY
KNFKLVVKATPQKKTEGQDWCLVHWILDYEKLKEETPEPFSLLELVVHTSKDIDDHHTKKK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G70830 MLP28 MLP-like protein 28 (.1.2.3.4.... Lus10012466 0 1
AT1G59840 CCB4 cofactor assembly of complex C... Lus10010732 1.0 0.8823
Lus10010327 4.6 0.8049
AT2G36540 Haloacid dehalogenase-like hyd... Lus10016365 5.7 0.8036
AT1G21150 Mitochondrial transcription te... Lus10039174 7.1 0.8642
Lus10021139 8.7 0.8636
AT5G66130 ATRAD17 RADIATION SENSITIVE 17 (.1) Lus10041883 9.8 0.8213
AT2G29120 ATGLR2.7 GLUTAMATE RECEPTOR 2.7, gluta... Lus10003436 17.0 0.8015
AT5G64250 Aldolase-type TIM barrel famil... Lus10006545 18.7 0.8188
AT1G45110 Tetrapyrrole (Corrin/Porphyrin... Lus10024288 22.2 0.7798
AT1G02520 MDR8, ABCB11, P... multi-drug resistance 8, ATP-b... Lus10004530 25.7 0.7710

Lus10012466 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.