Lus10012467 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G70890 81 / 7e-20 MLP43 MLP-like protein 43 (.1)
AT1G70840 79 / 4e-19 MLP31 MLP-like protein 31 (.1)
AT1G70830 77 / 2e-18 MLP28 MLP-like protein 28 (.1.2.3.4.5)
AT1G70850 78 / 7e-18 MLP34 MLP-like protein 34 (.1.2.3)
AT5G28010 67 / 2e-14 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G70880 62 / 6e-13 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G23130 52 / 5e-09 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT5G28000 49 / 7e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G35260 45 / 2e-06 MLP165 MLP-like protein 165 (.1)
AT1G14940 42 / 4e-05 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020497 166 / 1e-53 AT1G70840 148 / 4e-46 MLP-like protein 31 (.1)
Lus10020498 99 / 4e-27 AT1G70830 160 / 7e-51 MLP-like protein 28 (.1.2.3.4.5)
Lus10012466 97 / 5e-26 AT1G70830 161 / 3e-51 MLP-like protein 28 (.1.2.3.4.5)
Lus10012742 96 / 6e-26 AT1G70830 158 / 6e-50 MLP-like protein 28 (.1.2.3.4.5)
Lus10002644 62 / 1e-13 AT1G70850 58 / 1e-11 MLP-like protein 34 (.1.2.3)
Lus10008932 47 / 9e-07 AT4G14060 127 / 1e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10030840 39 / 0.0002 AT1G24020 189 / 2e-62 MLP-like protein 423 (.1.2)
Lus10030646 39 / 0.0003 AT1G24020 189 / 3e-62 MLP-like protein 423 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G111000 88 / 7e-23 AT1G70830 175 / 8e-57 MLP-like protein 28 (.1.2.3.4.5)
Potri.017G051200 59 / 7e-12 AT1G70840 116 / 3e-34 MLP-like protein 31 (.1)
Potri.017G051100 57 / 6e-11 AT1G70840 115 / 3e-33 MLP-like protein 31 (.1)
Potri.008G131300 50 / 3e-08 AT1G14930 100 / 1e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.008G131100 49 / 5e-08 AT1G70890 107 / 3e-30 MLP-like protein 43 (.1)
Potri.008G131200 41 / 6e-05 AT1G14930 122 / 4e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF00407 Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence
>Lus10012467 pacid=23145772 polypeptide=Lus10012467 locus=Lus10012467.g ID=Lus10012467.BGIv1.0 annot-version=v1.0
ATGAATGATCCAGTTGCTAGCATCGAGCTTTGCCCAATTGGCCCCGGAGTCGCAATCGGGCAAGGTGGAGGCACAGTTTGCCATCAGACTTGCTGCAAAA
TAATTCCACAGTATCTTCAGTGCCAGACCTCACCATGTTTCCAACATGGCCCTAACAAGATCAAGAGCTGCGCTATGCATCAAGGCGACTGGGGCAAAAA
GGGCACCGCCATTGTCTGGGACTACATCCACGGGGATATAACAAAGGATTACAAGGAGTTTAAGATAACTGTGAAGGCGACTCCTCAATCAGCAGAGACA
AGTCTGATCCATTGGACGCTGGAGTATGAGAAGCTGAGTGAGGGCTTTCTTGACACGGATGTCATCTCCATTCTTAACTTCGTTGTCCACGTGAGCAAAG
ACATTGATGATCACCACACCAACCGCAACAACTAG
AA sequence
>Lus10012467 pacid=23145772 polypeptide=Lus10012467 locus=Lus10012467.g ID=Lus10012467.BGIv1.0 annot-version=v1.0
MNDPVASIELCPIGPGVAIGQGGGTVCHQTCCKIIPQYLQCQTSPCFQHGPNKIKSCAMHQGDWGKKGTAIVWDYIHGDITKDYKEFKITVKATPQSAET
SLIHWTLEYEKLSEGFLDTDVISILNFVVHVSKDIDDHHTNRNN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G70890 MLP43 MLP-like protein 43 (.1) Lus10012467 0 1
AT1G64660 ATMGL methionine gamma-lyase (.1) Lus10000880 1.0 0.9198
AT5G09970 CYP78A7 "cytochrome P450, family 78, s... Lus10006821 1.4 0.9130
Lus10005608 2.4 0.8884
AT5G43080 CYCA3;1 Cyclin A3;1 (.1) Lus10026598 6.3 0.8048
AT1G14185 Glucose-methanol-choline (GMC)... Lus10024728 7.9 0.8410
AT1G49320 ATUSPL1 unknown seed protein like 1 (.... Lus10032324 8.7 0.8577
AT1G55790 Domain of unknown function (DU... Lus10032899 10.4 0.7683
AT3G42640 AHA8 H\(+\)-ATPase 8, H\(+\)-ATPase... Lus10019064 10.4 0.8207
Lus10019580 10.8 0.8107
AT1G53830 ATPME2 pectin methylesterase 2 (.1) Lus10027556 11.8 0.8642

Lus10012467 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.