Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G18240 95 / 9e-25 Ribosomal protein S24/S35, mitochondrial (.1.2) AT4G21460 92 / 1e-23 Ribosomal protein S24/S35, mitochondrial (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008778 [exp] 100 / 1e-26 AT3G18240 520 / 0.0 Ribosomal protein S24/S35, mitochondrial (.1.2) Lus10020495 [exp] 42 / 1e-05 AT3G18240 233 / 8e-75 Ribosomal protein S24/S35, mitochondrial (.1.2) Lus10022237 [exp] 0 / 1 AT3G18240 513 / 0.0 Ribosomal protein S24/S35, mitochondrial (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G044100 [exp] 98 / 5e-26 AT3G18240 461 / 2e-161 Ribosomal protein S24/S35, mitochondrial (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0337 [flax] [poplar] RF PF10213 [flax] [poplar] MRP-S28 Mitochondrial ribosomal subunit protein
Representative CDS sequence Show only first row Show all	>Lus10012470 pacid=23145797 polypeptide=Lus10012470 locus=Lus10012470.g ID=Lus10012470.BGIv1.0 annot-version=v1.0 ATGACCCACTACGCGAGGGGCCAATTCTTAGGTGGACAACACGAGCGGTCTTTGCCGCCGGTGGTGAATGGTGATGTGTGGCATCCCAAAAACAGGAAAG TCAAGATGTCAGTTACTGTCAAGGAACTTGGCCTTTCAAAGCATCAATTTAAGAGGTTAAGAGAACTGGTTGGCAATCGTTATCATCCTGGTAGAGATGA ATTTACAATCACTAGTGAGAGGTAG
AA sequence Show only first row Show all	>Lus10012470 pacid=23145797 polypeptide=Lus10012470 locus=Lus10012470.g ID=Lus10012470.BGIv1.0 annot-version=v1.0 MTHYARGQFLGGQHERSLPPVVNGDVWHPKNRKVKMSVTVKELGLSKHQFKRLRELVGNRYHPGRDEFTITSER

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G18240			Ribosomal protein S24/S35, mit...		Lus10012470 [exp]	0	1
AT2G45330		TRPT, EMB1067	2' tRNA phosphotransferase, em...		Lus10015875 [exp]	18.7	0.5609
AT1G74260		PUR4	purine biosynthesis 4 (.1)		Lus10040273 [exp]	104.5	0.4341
AT1G29450			SAUR-like auxin-responsive pro...		Lus10007057 [exp]	162.8	0.4094
AT1G12920		ERF1-2	eukaryotic release factor 1-2 ...		Lus10028313 [exp]	195.5	0.4420

Compare expression of checked genes

Lus10012470 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.