Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G14610 154 / 2e-48 PR-1, PR1, ATPR1 pathogenesis-related gene 1 (.1) AT2G14580 145 / 1e-44 ATPRB1 basic pathogenesis-related protein 1 (.1) AT4G33730 140 / 7e-43 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33720 140 / 9e-43 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G19690 139 / 3e-42 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G19990 135 / 1e-40 PR-1-LIKE pathogenesis-related protein-1-like (.1) AT1G50060 131 / 3e-39 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G26130 130 / 9e-39 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25790 119 / 5e-34 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33710 114 / 1e-32 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025697 [exp] 155 / 1e-48 AT1G50060 213 / 1e-71 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10007102 [exp] 150 / 1e-46 AT2G14610 182 / 3e-59 pathogenesis-related gene 1 (.1) Lus10020493 [exp] 140 / 7e-43 AT2G14610 206 / 9e-69 pathogenesis-related gene 1 (.1) Lus10012479 [exp] 140 / 8e-43 AT2G14610 208 / 7e-70 pathogenesis-related gene 1 (.1) Lus10020481 [exp] 139 / 6e-42 AT2G14610 176 / 6e-57 pathogenesis-related gene 1 (.1) Lus10020491 [exp] 137 / 1e-41 AT2G14610 207 / 2e-69 pathogenesis-related gene 1 (.1) Lus10020480 [exp] 136 / 8e-41 AT2G14610 182 / 3e-59 pathogenesis-related gene 1 (.1) Lus10005557 [exp] 122 / 2e-35 AT4G31470 199 / 2e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10013693 [exp] 122 / 3e-35 AT4G31470 196 / 1e-64 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G082800 [exp] 206 / 5e-69 AT2G14610 171 / 4e-55 pathogenesis-related gene 1 (.1) Potri.009G083600 [exp] 160 / 7e-51 AT1G50060 205 / 1e-68 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083100 [exp] 160 / 1e-50 AT2G14610 201 / 4e-67 pathogenesis-related gene 1 (.1) Potri.009G083300 [exp] 159 / 3e-50 AT2G14610 203 / 9e-68 pathogenesis-related gene 1 (.1) Potri.001G288301 [exp] 159 / 3e-50 AT2G14580 202 / 1e-67 basic pathogenesis-related protein 1 (.1) Potri.009G083000 [exp] 152 / 2e-47 AT4G33720 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.001G288600 [exp] 151 / 3e-47 AT2G14610 214 / 6e-72 pathogenesis-related gene 1 (.1) Potri.001G288401 [exp] 148 / 4e-46 AT2G14610 178 / 4e-58 pathogenesis-related gene 1 (.1) Potri.009G082900 [exp] 144 / 1e-43 AT2G14610 179 / 5e-58 pathogenesis-related gene 1 (.1) Potri.018G007000 [exp] 129 / 2e-38 AT4G31470 185 / 6e-60 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0659 [flax] [poplar] CAP PF00188 [flax] [poplar] CAP Cysteine-rich secretory protein family
Representative CDS sequence Show only first row Show all	>Lus10012478 pacid=23145765 polypeptide=Lus10012478 locus=Lus10012478.g ID=Lus10012478.BGIv1.0 annot-version=v1.0 ATGCCAATTATGTTGCTAGCAATAACACTCGTCGCCGGGCACTACCTCCTCCTCCTTATAAACCCACCTCTGATCACAGCGTCCCCAATACCACTAAACT CCCCAAGAAACTACGTGACAGCCCACAATGCTGTACGGGCCGCGGTGGGTGTGGGCCCAGTGACATGGAACGCCACTGTGGCAGCATACGCACAGGCTTA CGCCGAGTCTAGGGTCCACGAGAACTGCGAGCTGGAGCACTCCGGCGGTCCCTACGGGGAGAACATAGCCGAAGGTTACGGAGACTTGGAAGGCGCCGAC GCAGTCAAGATGTGGGCCAGCGAAAAGCCCAACTACGACTACGGCTCTAACTCTTGCGTTGGCAGCGGCGGTGGCGAAGACGACGAGTCGTGCCTGCACT ACACGCAGATAGTGTGGAGGAAATCGGTGCGGGTCGGGTGCGGGAGAGTCAAGTGCGATAATGGATGGGTTTTTGTGACCTGTAACTATGACCCTGTTGG CAATATTGAAGGCCAGCGTCCCTATTGA
AA sequence Show only first row Show all	>Lus10012478 pacid=23145765 polypeptide=Lus10012478 locus=Lus10012478.g ID=Lus10012478.BGIv1.0 annot-version=v1.0 MPIMLLAITLVAGHYLLLLINPPLITASPIPLNSPRNYVTAHNAVRAAVGVGPVTWNATVAAYAQAYAESRVHENCELEHSGGPYGENIAEGYGDLEGAD AVKMWASEKPNYDYGSNSCVGSGGGEDDESCLHYTQIVWRKSVRVGCGRVKCDNGWVFVTCNYDPVGNIEGQRPY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10012478 [exp]	0	1
AT5G05340			Peroxidase superfamily protein...		Lus10006534 [exp]	2.4	0.8605
AT1G65680		ATHEXPBETA1.4, ...	expansin B2 (.1)		Lus10038933 [exp]	2.8	0.8451
AT1G80100		AHP6	histidine phosphotransfer prot...		Lus10023127 [exp]	2.8	0.8637
AT2G43870			Pectin lyase-like superfamily ...		Lus10002123 [exp]	3.9	0.8572
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10016353 [exp]	5.7	0.8366
AT1G71050		HIPP20	heavy metal associated isopren...		Lus10016708 [exp]	9.8	0.8288
AT5G35370			S-locus lectin protein kinase ...		Lus10025617 [exp]	12.5	0.8602
AT1G22990		HIPP22	heavy metal associated isopren...		Lus10036004 [exp]	13.5	0.8182
AT5G54510		DFL1, GH3.6	DWARF IN LIGHT 1, Auxin-respon...		Lus10018510 [exp]	15.4	0.8592
AT5G18560	AP2_ERF	PUCHI	Integrase-type DNA-binding sup...		Lus10033963 [exp]	23.6	0.7703

Compare expression of checked genes

Lus10012478 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.